SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000020719 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000020719
Domain Number 1 Region: 18-195
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 6.41e-65
Family MHC antigen-recognition domain 0.000000745
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000020719   Gene: ENSSTOG00000027163   Transcript: ENSSTOT00000024615
Sequence length 239
Comment pep:novel scaffold:spetri2:JH393920.1:46787:49097:-1 gene:ENSSTOG00000027163 transcript:ENSSTOT00000024615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFLLLLGPLTLTQTWARSHSLRYFHTAVFRAGHEEAFYTSVGYVDDTLFLSLDSDALNPR
VEPRAQWMEYETPAFWEAQTKISEGHKQKLHWNLRSTLHYFNQSEPGSHTFQWISGCDLE
PNGSLLQGHEEFAYDGADYISLNEDLRSWSSWDKAAQITQRKWEDSGDAEHYRAYLQEEC
LEWLCRFLEKGKDKLLHTESPALSIIPVMGIVAGLVLFVVVVTGAAGAVMRWWQNAGRE
Download sequence
Identical sequences ENSSTOP00000020719 ENSSTOP00000020719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]