SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000020976 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000020976
Domain Number 1 Region: 272-513
Classification Level Classification E-value
Superfamily Caspase-like 5.08e-75
Family Caspase catalytic domain 0.00000104
Further Details:      
 
Domain Number 2 Region: 20-119
Classification Level Classification E-value
Superfamily DEATH domain 1.65e-19
Family DEATH effector domain, DED 0.0044
Further Details:      
 
Domain Number 3 Region: 114-195
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000153
Family DEATH effector domain, DED 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000020976   Gene: ENSSTOG00000002364   Transcript: ENSSTOT00000019786
Sequence length 525
Comment pep:known_by_projection scaffold:spetri2:JH393536.1:460556:485518:1 gene:ENSSTOG00000002364 transcript:ENSSTOT00000019786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSQDQSLDSSSDETCQLRFREKLLAIDLELKVQDVESLKFLCRGFIPQNKMDKCSSAL
QLFDYLTTGEMISVKDTFFLAELLYTIKQNYLLRHLDYTKQQVECFLPIRGKLSPFRKLL
FELSEGIDEENLKAIIFLLADKIPKGLTSSLSLFADLEKNTEIDEDNVILLEKVFKKVAP
FLLRKIENYKREKAAQEVTPPVDKETESLPQGQEEIFTPSDIKRFHGALTEGLWQNEHSM
NHGNGATNGALIPVSMEMVGASANTLGSEIWTKETIMYRMDRKHRGHCIIINNHSFTSLK
DRPGTHRDAECLKLVFEWLGFTAHKYDDVTKGVMDKILQEYKSHPGHADGDCFVFCILTH
GEFGAVYSSDGVLIPIRSIMYHFTAQQCPGLAHKPKLFFIQACQGSEVQTSVLTEADAQN
SKHLSLMDSVPTEADFLLGLATVPGYMSFRHIRDGSWYIQSLCSHLKKLVPRQEDILSIL
TAVNNDVSQQVNSDGTLRQMPQPAFTLRRKYSLCHRMSFYYCREF
Download sequence
Identical sequences ENSSTOP00000020976 ENSSTOP00000002115

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]