SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000021040 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000021040
Domain Number 1 Region: 2-235
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.38e-80
Family PDEase 0.00000000266
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000021040   Gene: ENSSTOG00000025252   Transcript: ENSSTOT00000029684
Sequence length 241
Comment pep:novel scaffold:spetri2:JH393679.1:92584:113596:1 gene:ENSSTOG00000025252 transcript:ENSSTOT00000029684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSRLTDLEVLALLIAALSHDLDHRGVNNSYIQRTEHPLAQLYCHSIMEHHHFDQCLMILN
SPGNQILSGLSVEEYKATLKMIKQAILATDLALYIKRRGEFFELIRKNQFNLEDPHQKEL
FLAMLMTACDLSAITKPWPIQQRIAELVAAEFFDQGDRERKELNIEPTDLMNREKKNKIP
SMQVGFIDAVCLQLYEALTHVSEDCRPLLEGCQRNRQKWQALAEQQEKTLVNGESGQAKR
N
Download sequence
Identical sequences ENSSTOP00000021040 ENSSTOP00000021040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]