SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000021926 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000021926
Domain Number 1 Region: 15-269
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.45e-29
Family Calpain large subunit, catalytic domain (domain II) 0.0091
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000021926
Domain Number - Region: 607-642
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.000834
Family Calpain large subunit, catalytic domain (domain II) 0.038
Further Details:      
 
Domain Number - Region: 768-837
Classification Level Classification E-value
Superfamily Globin-like 0.00103
Family Globins 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000021926   Gene: ENSSTOG00000024238   Transcript: ENSSTOT00000025608
Sequence length 1653
Comment pep:known_by_projection scaffold:spetri2:JH393299.1:102850:251289:1 gene:ENSSTOG00000024238 transcript:ENSSTOT00000025608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LYSFGSNVVPSTGEQKKGKFPIWPEWSEADINAEKWDAGKSGKEKDKTGKSPVFVNFRKP
QNSSSVPALIRFFLWHRIRNIFLFQVPVVVKNEIMFDLFSANEHLLCSELMRWIISEIYA
VWKIFNGGILSNYFKGTPGEPPLLLWKPWEHIYSLCKAVKGHMPLFNSYGKYVVKLYWMG
CWRKITVDDIMPFDEDNNLLLPVSTCEFELWPMLLSKAIIKLANVDIHIAQRQELGEFTV
IHALTGWLPEVISLHPGYMDKVWDLLKEILPEFKLPDELNSESKIAEIENKLKEQGKETK
DSKEVKDGKEVKDSKEFKTDGSLTALKPPEKGDKVTKEKTDMKDLGKKKSKDGEKEKEKE
KEKEKFKFSIHGSRPSSDVQHSMQSLSDCSSGIQSPHMAVYATFTPLYLFENKIFSLEKM
ANSAEKLREYGLSHICSHPVLVTRSRSCPLTAPPKPPPLPRWKLIRPKKEMVITDEPQEP
VIKKPEQFLEISSPFLNYRMTPFTIPTETHYVQSVIKKGVTPGSGLPSLMENDETISHSQ
PELNQITGMISQGNTSSQVGVGKGTDEQIDLGLNDIHQIDGTGLEKDAVSQITEIHEKSQ
EELVAINNGVSKEIWLDFEDFCVCFQNIYVFHKPSSYCVNFQKSEFKFSDERVSYYLFVD
SLKPIELLVCFSALVRWGESGGLMKDSPPIEPGLLTAEAISWKSLKPRSLVLKIHTYAAK
AAMLRLPVGRHMLLFTVYSPVGHSVHVCSMVTFVIGDEDVVLPNFEPESYRFTEQALLIM
KAVGNVIANFRDKVRLSAALKDLQAAHYPVPLHDKELMVQHFRVFYISLWRLMKKAQMAK
PLSNFKFAFRAMVLDVELLDSSLEDVSLAEWIDAKFFLPSSNDKEYSPEEMAAAIKIQSM
WRGTYIRLLMKARTPETKENASVADTLQKVWAMLEMNLEQYAVSLLRLMFKSKCKSIESY
PCYQDEETKISFADYSVTYPDQPPNSWFIVFRETFLFPQDMILVPKVYTTLPVCILHVVN
NDTMEQVPKVFQKVVPHLYTKNKKGYTFVAEAFTGDMYAASSRWKLRLIGSYTPLPCLSR
ESPCNTFTIKEIRDYYIPNDKKILFRYCVKVALQHPLTIQVRTSKPDVFIKLQVLENEET
MVSSIGKGQALIPAFNFLGSEKTVSSQSSKQILSSHLSTKKEPEVYSKKKSAQGSQKSYK
SRPGSAIVDTGQPLVEEEVVTMSSVEENSSIPQQNYKYIIQCLILYNSWPLTESQQIFVQ
ALKELEKSDNKAHGEKHEELITMGSPDSHTISEGQKSSGTSKTTRKGKEKSSDRERSTKE
KQAPRFEPQVPAVQLQQEDPNKPYWILRLVSEHSETELFDVKKDTERADEIRAMKQAWET
TEPGRAIKASQARLLYLNQLFKRPPDFPESLLLPDSQIKFGEEGLTFTAAQFLKETDAKS
LQRQESRDILLSGGGSMLWKKWQLSKGLKDLTKTVSSESGIVPSPGKEEREQNLKKETIG
AGQQSRSPTILEISPELIQKALEYVDLSQYVRKTNDEAVLQTEELNRLQTMQKAEEIHQF
RQYRNRMLSIRDVDQEERTKLKDEVLDMYGEMRDSLDEARQKIFTIREEYRNKLLEAERL
RLEALAAQEAAMRAESEKKTPAPDAKRKKGKKK
Download sequence
Identical sequences ENSSTOP00000021926 ENSSTOP00000021926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]