SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000021996 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000021996
Domain Number 1 Region: 85-160
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 3.14e-31
Family Skp1 dimerisation domain-like 0.00000773
Further Details:      
 
Domain Number 2 Region: 3-70
Classification Level Classification E-value
Superfamily POZ domain 2.46e-25
Family BTB/POZ domain 0.0000359
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000021996   Gene: ENSSTOG00000022870   Transcript: ENSSTOT00000027031
Sequence length 163
Comment pep:novel scaffold:spetri2:JH393384.1:1419836:1420560:1 gene:ENSSTOG00000022870 transcript:ENSSTOT00000027031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLQDLGMDDEGDDDPVPLPNVNAAILKKVIQ
WCTHHKDDPPPPEDDENKEKQTDDIPVWDQEFLKVDQGTLFELILAANYLDIKSLLDVTC
KTVANMIKGKTPEEIHKTFNIKNDFTEEEEAQVRKENQWCEEK
Download sequence
Identical sequences I3NC99
ENSSTOP00000021996 XP_005330878.1.77405 ENSSTOP00000021996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]