SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000022581 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000022581
Domain Number 1 Region: 340-746
Classification Level Classification E-value
Superfamily Phosphofructokinase 3.4e-112
Family Phosphofructokinase 0.00000936
Further Details:      
 
Domain Number 2 Region: 8-348
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.02e-105
Family Phosphofructokinase 0.000000269
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000022581   Gene: ENSSTOG00000026523   Transcript: ENSSTOT00000027561
Sequence length 780
Comment pep:known_by_projection scaffold:spetri2:JH393310.1:93978:117515:-1 gene:ENSSTOG00000026523 transcript:ENSSTOT00000027561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATVDLEKLRMSGAGKAIGVLTSGGDAQGMNAAVRAVTRMGIYVGAKVFLIYEGYEGLVE
GGENIKPANWLSVSNIIQLGGTVIGSARCKAFTTREGRLAAAYNLVQRGITNLCVIGGDG
SLTGANIFRSEWGSLLEELVGEGKISEHTAQTYSHLNIAGLVGSIDNDFCGTDMTIGTDS
ALHRIMEVIDAITTTAQSHQRTFVLEVMGRHCGYLALVSALASGADWLFIPESPPEDGWE
NFMCERLGETRSRGSRLNIIIIAEGAIDRNGKPISSSYVKDLVVQRLGFDTRVTVLGHVQ
RGGTPSAFDRVLSSKMGVEAVMALLEATPDTPACVVSLSGNQPVRLPLMECVQVTKEVQK
AMDDRRFDEAIQLRGRSFENNWNIYKLLAHQKLSKEKTNFSLAILNVGAPAAGMNAAVRS
AVRTGISHGHTVYVVHDGFEGLAKGQVQEVGWHDVAGWLGRGGSMLGTKRTLPKAHLEAI
VENLRTYNIHALLVIGGFEAYEGVLQLVEARGRYEELCIVMCVIPATISNNVPGTDFSLG
SDTAVNAAMESCDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAVGADAAYVFEDPFN
IHDLKANVEHMTEKMKTDIQRGLVLRNEKCHEHYTTEFLYNLYSSEGKGVFDCRTNVLGH
LQQGGAPTPFDRNYGTKLGVKAMLWMSEKLRAVYRKGRVFANAPDSACVIGLRKKAVAFS
PVTELKKDTDFEHRMPREQWWLSLRLMLKMLAHYRINMASYVSGELEHVTRRTLSIDKGF
Download sequence
Identical sequences I3NDY4
ENSSTOP00000022581 ENSSTOP00000022581 XP_005323496.1.77405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]