SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000022598 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000022598
Domain Number 1 Region: 20-144
Classification Level Classification E-value
Superfamily Lysozyme-like 1.77e-37
Family C-type lysozyme 0.0000991
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000022598   Gene: ENSSTOG00000024182   Transcript: ENSSTOT00000021502
Sequence length 145
Comment pep:known_by_projection scaffold:spetri2:JH393505.1:2668444:2674605:1 gene:ENSSTOG00000024182 transcript:ENSSTOT00000021502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKASVMLFLLGYLMVPSGARVLGRCTVADMLYRGGLDYFEGYKLENWVCLAYYESKFNPS
AVYENEITGHTGFGLFQIREDLWCDHGKNLCSVSCSELLNPDLKKTIECVKKIVKGKQGM
GAWLNWTRNCQFSDTLSRWLDGCRL
Download sequence
Identical sequences I3NE01
ENSSTOP00000022598 XP_005337996.1.77405 ENSSTOP00000022598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]