SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000022926 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000022926
Domain Number 1 Region: 578-642
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000375
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 506-552
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000275
Family TSP-1 type 1 repeat 0.00064
Further Details:      
 
Domain Number 3 Region: 633-689
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000778
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 4 Region: 33-80
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000955
Family TSP-1 type 1 repeat 0.0018
Further Details:      
 
Domain Number 5 Region: 85-126
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000336
Family LDL receptor-like module 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000022926
Domain Number - Region: 458-496
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0804
Family EGF-type module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000022926   Gene: ENSSTOG00000019606   Transcript: ENSSTOT00000020167
Sequence length 850
Comment pep:known_by_projection scaffold:spetri2:JH393328.1:1689328:1731770:-1 gene:ENSSTOG00000019606 transcript:ENSSTOT00000020167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQTISLFIFVGFIGEFQVFSRHFETTTSASSPVNCQWDSYGPWSECSGCTKTQTRTRSIA
VYGQYGGQPCAGSAFETRSCEPTQGCPTEEGCGERFRCFSGQCISKSLVCNGDSDCEEDG
ADEDRCENSERRTLCDTDKPPPNIELTGNGYNGVRAGRRREPIQSWGFVLKRMKRHQNDS
RNFWKLSYNVLFYSHEVKVNNDFNYEFYNSSWSYVKQTSEEHTSSSKRSSFFHSSSSASH
SYKSNFNEIYKKKSYQLLVIQNTVEVAQFINNNPEFLQLAEPFWKELSHLPSVYDYSAYR
RLIDQYGTHYLQSGSLGGEYRVLFYVDFGKVKESGSVSLEHMTCTSSDFRFLFESSEQKC
KELEDALKLGSGNQNNVLRGVPFVRGGGPGFIAGLSFLQLDNPAGNKRRYSDWAESVTSL
PQVIKQKLTPIYELVKEVPCASVKRLYLKRALEEYVDEFHPCHCRPCQNGGLATVGETQC
QCHCKPYTFGVACEQGVLVGNQAGGVDGGWSCWSSWGPCVQGKKARNRECNNPPPSRGGK
SCVGETTESRQCQDKELEHLRLLEPHCFPVSLVPKEFCPSPPALKDGFVQGEGTVFPVGK
KILYTCNEGYSLVGDPVARCGEDLQWLVGEMYCQKIACVLPELMNGIQSQPHKPFYSVGE
KVTLSCSGGMSLEGPSAFLCGSSLKWSPEMKNVQCVQKDTPLTQAVPKCQRWEKLQNSRC
VCKMPYECGSSLDVCARDERSQRILPLTVCKLHVLHCQGRNYTLTGRDRCTLPASAKKAC
GACPLWEKCDGSSGKCVCREASECQEEGFRVCVEVSGKELTMSECEAGVLRCRGQSISVT
SMKPCAAETQ
Download sequence
Identical sequences ENSSTOP00000022926 ENSSTOP00000022926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]