SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000023090 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000023090
Domain Number 1 Region: 121-505
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 8.1e-42
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000000716
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000023090   Gene: ENSSTOG00000027561   Transcript: ENSSTOT00000029570
Sequence length 515
Comment pep:known_by_projection scaffold:spetri2:JH393302.1:10185058:10227502:-1 gene:ENSSTOG00000027561 transcript:ENSSTOT00000029570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVDEYWLCLPASGIRPFVQTIRVIWSCPHCCWTVPLAPESPCAPGMLPGDTCRAEPPPP
PHSSTAPPSTSQAPCFAGPKSCPSSATPDCRQEKNMQSGLACEDSFQQQLKMNGSEDLPE
SYDFDLIIIGGGSGGLAAAKARLLEAAKYDKKVMVLDFVTPTPLGTRWGLGGTCVNVGCI
PKKLMHQAALLGQALKDSRNYGWNFEDNVKHDWEKMTEAVQNHIGSLNWGYRVALREKKV
VYENAFGQFIGPHRIKATNNKGKEKFYSAERFLIATGERPRYLGIPGDKEYCISSDDLFS
LPYCPGKTLVVGASYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMANKIGEHMEEHGI
KFIKQFVPIKIEQIEAGTPGRLRVTAQSTNSEEIIEGEYNTVLLAIGRDSCTRNIGLETV
GVKINEKTGKIPVTDEEQTNVPYIYAIGDILEGKLELTPVAIQAGRLLAQRLYAGSTILC
DYENVPTTVFTPLEYGACGLSEEKAVEKFGEENIE
Download sequence
Identical sequences ENSSTOP00000023090 ENSSTOP00000023090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]