SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000023422 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSTOP00000023422
Domain Number - Region: 190-269
Classification Level Classification E-value
Superfamily TIMP-like 0.00981
Family Tissue inhibitor of metalloproteinases, TIMP 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000023422   Gene: ENSSTOG00000022577   Transcript: ENSSTOT00000029982
Sequence length 304
Comment pep:known_by_projection scaffold:spetri2:JH393733.1:23825:442069:1 gene:ENSSTOG00000022577 transcript:ENSSTOT00000029982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AARRRAGLLIPRSPGPGPGPRPSPPLLLLLAVLLGGAGAQYSSDLCSWKGSGLTHEAHRK
EVEQVYLRCAAGSVEWMYPTGALIVNLRPNTFSPSRGLTVCIKPFSGSSGANIYLERTGE
LRLLVQDGSSHAGQVQCFSLEQGGLFVEATPQQDISRRTTGFLYELTSGRRGLGHTLSAP
CRPCSDTEVLLAVCTSDFVVRGSIQDVTHVPERQESVIHLRVSRLYRQKSRVFQPAPEGH
GHWQGRILTLLECGVRPGLGDFLFTGHMHFGEAQLGCAPRFSDFRRTYRDAEERGLNPCE
IGME
Download sequence
Identical sequences ENSSTOP00000023422 ENSSTOP00000023422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]