SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000023565 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000023565
Domain Number 1 Region: 124-166
Classification Level Classification E-value
Superfamily SAP domain 0.000000000000275
Family SAP domain 0.0086
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000023565
Domain Number - Region: 26-106
Classification Level Classification E-value
Superfamily Saposin 0.0157
Family Ameobapore A 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000023565   Gene: ENSSTOG00000022414   Transcript: ENSSTOT00000024539
Sequence length 179
Comment pep:known_by_projection scaffold:spetri2:JH393339.1:2774666:2777862:1 gene:ENSSTOG00000022414 transcript:ENSSTOT00000024539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWATHGLAVALALSVLPGSGALRPGDCEVCISFLGRFYQDLKDRDVTFSPATIEKELIKF
CREARGKENRLCYYIGATDDAATKIINEVSKPLAHHIPVEKICEKLKKKDSQICELKYDK
QIDLSTVDLKKLRVKELKKILDDWGETCKGCAEKSDYIRKINELMPKYAPKAASARTDL
Download sequence
Identical sequences A0A287DC82
ENSSTOP00000023565 XP_005327025.1.77405 XP_015342605.1.40921 ENSSTOP00000023565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]