SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000023855 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000023855
Domain Number 1 Region: 495-829
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.14e-113
Family PDEase 0.000000271
Further Details:      
 
Domain Number 2 Region: 53-249
Classification Level Classification E-value
Superfamily GAF domain-like 5.23e-38
Family GAF domain 0.00029
Further Details:      
 
Domain Number 3 Region: 236-280,307-456
Classification Level Classification E-value
Superfamily GAF domain-like 5.89e-31
Family GAF domain 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000023855   Gene: ENSSTOG00000020412   Transcript: ENSSTOT00000027341
Sequence length 856
Comment pep:known_by_projection scaffold:spetri2:JH393287.1:22419079:22472370:-1 gene:ENSSTOG00000020412 transcript:ENSSTOT00000027341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPMAPETGRSPRAPQPLFRRTNFLRKQLSPGHVPGACEDGCLVDCSSLRELCQVEESAAL
FALVQDMQENVSMERVVFTLLQHLCTILQADRCSLFMYRQRNSMAELATRLFSVQPGSTL
EDCLVPPDAEIVFPLDIGVVGHVAQTKKMVNVPDVTQDPHFSPFADELTDYVTRSILATP
IMNGKEVVAVIMAVNKLSGSCFTSEDEDVFKKYLNFAGLNLKIYHLSYLHNCETRRGQVL
LWSANKVFEELTDIERQFHKAFYTVRAYLNCDRYSVGLLDMTKEKEFFDVWPVLMGEAQP
YSGPRTPDGREIVFYKVIDYILHGKEDIKVIPTPPDDHWALASGLPTYVAESGFICNIMN
TSTDEMFKFQEGPLDDSGWVIKNVLSMPIVNKKEEIVGVATFYNRKDGKPFDEQDEVLME
SLTQFLGWSVLNTDTYDKVNKLENRRDIAQDMVLYHVRCDKDEIQMILPTRERLGKEPAD
CEEDELGKILKEELPGPTKFDIYEFHFSDLECTELELVKCGIQMYYELGVVRKFQIPQEV
LVRFLFSVSKAYRRITYHNWRHGFNVAQTMFTLLMTGKLKSYYTDLEAFAMVTAGLCHDI
DHRGTNNLYQMKSQNPLAKLHGSSILERHHLEFGKFLLAEESLNIYQNLNRRQHEHVIHL
MDIAIIATDLALYFKKRTMFQKIVDESKNYTDKKSWVEYLSLETTRKEIVMAMMMTACDL
SAITKPWEVQSKVALLVAAEFWEQGDLERTVLDQQPIPMMDRNKADELPKLQVGFIDFVC
TFVYKEFSRFHEEILPMFDRLQNNRKEWKALADEHEAKMKALEEKKEEEESVAAKKVGTE
ICNGDPAPKSSTCCIL
Download sequence
Identical sequences ENSSTOP00000023855 ENSSTOP00000023855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]