SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000000281 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000000281
Domain Number 1 Region: 79-108,146-214
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000432
Family Anti-sigma factor antagonist SpoIIaa 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000000281   Gene: ENSSTOG00000000314   Transcript: ENSSTOT00000000314
Sequence length 237
Comment pep:novel scaffold:spetri2:JH393354.1:4843168:4942740:1 gene:ENSSTOG00000000314 transcript:ENSSTOT00000000314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLIQFRDLKKYWNVDKIDWGIWVSTYIFTICFAANVGLLFGVVCTIAIVIGRFPRAKTLS
IKNMKEMEFKVKTETDDESLQQVKIISINNPLVFLNVKKFHMDLINIMQKENANNQPLDD
ISKCEQNTLLNSLSNGNCNEETAQSSSHDKSALILDCSGLTFFDYSGVAMLVEVYMDCKD
QSVDVLLANCTASLIKAMKYYGNLDSEKPIFFESVSAAISNIYSNKNFNKLSDHSEV
Download sequence
Identical sequences ENSSTOP00000000281 ENSSTOP00000000281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]