SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000000490 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000000490
Domain Number 1 Region: 812-992
Classification Level Classification E-value
Superfamily Nucleotide cyclase 9.73e-58
Family Adenylyl and guanylyl cyclase catalytic domain 0.00012
Further Details:      
 
Domain Number 2 Region: 74-425
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.22e-57
Family L-arabinose binding protein-like 0.00078
Further Details:      
 
Domain Number 3 Region: 508-777
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.42e-46
Family Protein kinases, catalytic subunit 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000000490   Gene: ENSSTOG00000000539   Transcript: ENSSTOT00000000543
Sequence length 1078
Comment pep:known_by_projection scaffold:spetri2:JH393397.1:2742911:2810969:1 gene:ENSSTOG00000000539 transcript:ENSSTOT00000000543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTPLLGLALCSLLFQPWLMLWASQFSQNCHNDRYEISVLMMNNSAFPEPLDKLREAVNE
GLDIVRMRLHEAGLNVTVNATFIYSDGLIHKSGDCRSSTCEGLDLLREITRKGQLGCALM
GPSCTYSTFQMYLDTQLNYPMISAGSFGLSCDYKETLTRLMSPARKLMYFLVDFWKINDL
PFKPFSWNTSYVYKDGNETEDCFWYLNALEAGVSYFSQVLSFKDTLRRDDQFRDIIVNHN
RKSNVIVMCGTPETFNSLKGDQEVAEDTVIILVDLFNDYYFEDKAIAPDYMKNVLVLTLP
PGNSMINTSLFSFLIQEKNDFALAYLDGTLLFGHMLKIFLENGEAIATSKFAHAFRNLTF
QGYTGPVTLDDCGDIDNTMVLLYASMDNQKYKILLTYDTHTNSTTAEDTRPSFVWRNHKL
PNDIPGRATGPQILMIAVFTLTGTVVLVLIIALLVLRKYKRDNQLRQKKWSHIPPENIFP
LENNETNQISLKIDDDKRRDTIQRLRQCKYDKKRVILKDLKHSDGNFNEKQKIELNKLLQ
TDYYNLTKFYGTVKLDSRIFGVIEYCERGSLREVLNDTISYPDGTFMDWEFKISVLYDIA
KGMSYLHSSKIEVHGRLKSTNCVVDSRMVVKITDFGCNSILLPKKDLWTAPEHLRQANIS
QKGDVYSFGIIAQEIILRRETFYTLSCRDQKEKIFRVENSNGMKPFRPDLFLETADEKEL
EVYLLVKSCWEEDPEKRPDFKKIENTLAKIFGLFHDQKNETYMDTLIRRLQLYSRNLEHL
VEERTQLYKAERDRADRLNFMLLPRLVVKSLKEKGIVEPELFEEVTIYFSDIVGFTTICK
YSTPMEVVDMLNDIYKSFDQIVDHHDVYKVETIGDAYVVASGLPKRNGNRHAVDISKMAL
DILSFIGTFELEHLPGLPVWIRIGVHSGPCAAGVVGIKMPRYCLFGDTVNTASRMESTGL
PYRIHMSSSTIATLKRTDCQFLYEVRGETYLKVTSLVSCFHYSETLDQQIAKLHLQKPPC
MENQQRLQEEFSDMILNSLQKRQAAGIKSRKPTRVASYKKGTLEYLQLNTTDQENTYF
Download sequence
Identical sequences ENSSTOP00000000490 ENSSTOP00000000490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]