SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000002747 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000002747
Domain Number 1 Region: 103-195
Classification Level Classification E-value
Superfamily Hormone receptor domain 5.23e-25
Family Hormone receptor domain 0.00085
Further Details:      
 
Domain Number 2 Region: 151-480
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000137
Family Rhodopsin-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000002747   Gene: ENSSTOG00000003066   Transcript: ENSSTOT00000003076
Sequence length 593
Comment pep:known_by_projection scaffold:spetri2:JH393406.1:674088:693129:1 gene:ENSSTOG00000003066 transcript:ENSSTOT00000003076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAARIAPGLALLLCCPVLSSAYALVDADDVFTKEEQIFLLHRAQAQCDKLLKEVLRTAA
NIMESDKGWTSASTSGKPRKEKASEKLYPESKEDKEVATGSRRRGRPCLPEWDYIVCWPL
GAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWEVVPGHNRTWANYSECLKFMTNETRE
REVFDRLGMIYTVGYSMSLASLTVAVLILAYFRRLHCTRNYIHMHMFLSFMLRAASIFVK
DAVLYSGFTLDEAERLTEEELHIIAQAPPPPAAAAVGYAGCRVAVTFFLYFLATNYYWIL
VEGLYLHSLIFMAFFSEKKYLWGFTVFGWGLPAVFVAVWVGVRATLANTGCWDLSSGHKK
WIIQVPILASVVLNFILFINIIRVLATKLRETNAGRCDTRQQYRKLLKSTLVLMPLFGVH
YTVFMALPYTEVSGTLWQIQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIKKSWSRWTLA
LDFKRKARSGSSSYSYGPMVSHTSVTNVGPRTGLGLPLSPRLLPAATTNGHSQLPGHAKP
GAPVLETLDTTPTVTAAPKEDGFLNGSCSGLDEEASGPERPPPLLQEEWETVM
Download sequence
Identical sequences I3M1M7
XP_005332981.1.77405 ENSSTOP00000002747 ENSSTOP00000002747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]