SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000003984 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000003984
Domain Number 1 Region: 49-137
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 9.61e-38
Family SCAN domain 0.000049
Further Details:      
 
Domain Number 2 Region: 211-256
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000183
Family KRAB domain (Kruppel-associated box) 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000003984   Gene: ENSSTOG00000004447   Transcript: ENSSTOT00000004441
Sequence length 260
Comment pep:known_by_projection scaffold:spetri2:JH393582.1:115:3643:-1 gene:ENSSTOG00000004447 transcript:ENSSTOT00000004441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARESRESIALDDHSADDQMGLLVIKVEEEEASAFAEEASLPCSPHQGKEHCRQRFRAFC
YPETAGPKEVLSQLRELCRQWLRPEMHSKEQILELLVLEQFLTILPRELQNWVRKQHPES
GEEVVVLLEYLEKHLDEPTLQVPGGDQGQELLCCKVALWTPTLESQNSQFPPVKTLLKCE
SLQCQPLQDRVAQGDSCREDTMLAARLTLESRGMLKTEDVDLTLTPEWTQVNSSQVNLYR
HERQENCDSLISLGKTNFSQ
Download sequence
Identical sequences ENSSTOP00000003984 ENSSTOP00000003984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]