SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000004954 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000004954
Domain Number 1 Region: 994-1084
Classification Level Classification E-value
Superfamily PDZ domain-like 4.86e-26
Family PDZ domain 0.00026
Further Details:      
 
Domain Number 2 Region: 813-917
Classification Level Classification E-value
Superfamily PDZ domain-like 1.01e-23
Family PDZ domain 0.0001
Further Details:      
 
Domain Number 3 Region: 374-480
Classification Level Classification E-value
Superfamily PDZ domain-like 1.04e-23
Family PDZ domain 0.0000532
Further Details:      
 
Domain Number 4 Region: 678-790
Classification Level Classification E-value
Superfamily PDZ domain-like 6.7e-22
Family PDZ domain 0.00043
Further Details:      
 
Domain Number 5 Region: 539-642
Classification Level Classification E-value
Superfamily PDZ domain-like 9.2e-17
Family PDZ domain 0.00023
Further Details:      
 
Domain Number 6 Region: 103-174
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.18e-16
Family Nucleotide and nucleoside kinases 0.0038
Further Details:      
 
Domain Number 7 Region: 269-306
Classification Level Classification E-value
Superfamily WW domain 0.00000000000046
Family WW domain 0.0014
Further Details:      
 
Domain Number 8 Region: 317-351
Classification Level Classification E-value
Superfamily WW domain 0.00000000125
Family WW domain 0.0029
Further Details:      
 
Domain Number 9 Region: 4-91
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000113
Family PDZ domain 0.03
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000004954
Domain Number - Region: 1116-1163
Classification Level Classification E-value
Superfamily Sec2 N-terminal region 0.0034
Family Sec2 N-terminal region 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000004954   Gene: ENSSTOG00000005528   Transcript: ENSSTOT00000005538
Sequence length 1453
Comment pep:known_by_projection scaffold:spetri2:JH393500.1:1847575:2082677:1 gene:ENSSTOG00000005528 transcript:ENSSTOT00000005538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XWAGPPGDFGAEIRGGAERGEFPYLGRLREEPGGGTCCVVSGKAPSPGDVLLEVNGTPVS
GLTNRDTLAVIRHFREPIRLKTVKPGKVINKDLRHYLSLQFQKGSIDHKLQQVIRDNLYL
RTIPCTTRAPRDGEVPGVDYNFISVEQFKALEESGALLESGTYDGNFYGTPKPPAEPSPF
QPDPVDQVLFDNEFDTESQRKRTTSVSKMERMDSSLPEEEEDEDKDAINGSGSAENRERH
SESSDWMKTVPSYNQTNSSVDFRNYMMRDETLEPLPKNWEMAYTDTGMIYFIDHNTKTTT
WLDPRLCKKAKAPEDCEDGELPYGWEKIEDPQYGTYYVDHLNQKTQFENPVEEAKRKKQL
GQTEIGSSKPDVEKSHFTRDPSQLKGVLVRASLKKSTMGFGFTIIGGDRPDEFLQVKNVL
KDGPAAQDGKIAPGDVIVDINGNCVLGHTHADVVQMFQLVPVNQYVNLTLCRGYPLPDDS
EDPVVDIVAATPVINGQSLTKGETCMNTQDFKAGAMVLDQNGKSGHILTSDRLNGASDPN
EQRASMASSGSSQPELVTIPLIKGPKGFGFAIADSPTGQKVKMILDSQWCQGLQKGDIIK
EIYHQNVQNLTHLQVVEVLKQFPVGADVPLLILRGGPSSPTKTAKMKTDKKENSGSLETI
NEPIPQPMPFPPSIIRSGSPKLDPSEVYLKSKTLYEDKPPNTKDLDVFLRKQESGFGFRV
LGGDGPDQSIYIGAIIPLGAAEKDGRLRAADELMCIDGIPVKGKSHKQVLDLMTTAARNG
HVLLTVRRKIFYGEKQPEDDSSHAFISTQNGSPRLNRPEVSARPAPQEAYDVVLQRKENE
GFGFVILTSKNKPPPGVIPHKIGRVIEGSPADRCGKLKVGDHISAVNGQSIIELSHDSIV
QLIKDAGITVTLTVVAEEEHHGPPSGTNSARQSPALQHRPMGQSQANHLPGDRSALEGEI
GKDVSASYRHSWSDHKHLAQPDTAVISVVGSRHNQSLGCYPVELERGPRGFGFSLRGGKE
YNMGLFILRLAEDGPAIKDGRIHVGDQIVEINGEPTQGITHTRAIELIQAGGNKVLLLLR
PGTGLIPDHGDWDINNPSSSNVIYDEQSPFPPSLHSASIFEECHVPVIEESLTRVQICEK
AEELKDTIPEKNSTLNENQPEIKHQSLLQKNVNKRDPTNSPGHRNKKNLKIENGVTQRGR
SASPKKPANRQLEEHMEKNPRPLKNDPRRQPRDRSLSPRKGENKSCPINTKAGSEQNQCR
KSRGQSSSPKKQQKLEGGKDPANASAKLLEGESRRIAGHTGDNTEQIPDGKEKSGAIRKE
LKQSPLEKNRTRSPEKKSKRMDEKSLPSKKKGNTAGGVGSENERGRQATSGEMRPGKDKI
GENGQLSEKKLKQEPEDDHKGKDLEAADTRQEGGRVKPESSSPVKKAPITPGPWKVPSAK
KVTGTAGVAEKRL
Download sequence
Identical sequences ENSSTOP00000004954 ENSSTOP00000004954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]