SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000005523 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000005523
Domain Number 1 Region: 68-188
Classification Level Classification E-value
Superfamily PX domain 0.0000000000000111
Family PX domain 0.0044
Further Details:      
 
Domain Number 2 Region: 269-323
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000216
Family SAM (sterile alpha motif) domain 0.0052
Further Details:      
 
Domain Number 3 Region: 862-892
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000331
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000005523   Gene: ENSSTOG00000006167   Transcript: ENSSTOT00000006174
Sequence length 901
Comment pep:known_by_projection scaffold:spetri2:JH393451.1:1728592:1780645:1 gene:ENSSTOG00000006167 transcript:ENSSTOT00000006174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGGPGGKSAPGPGGALPTCPACHKMAPRPEAPLHGVGNSLEKALHTSAHSTEEALPKRPV
GKHGKVSVEKIDLKGLSHTHSDRNVDCSFEVLWSDSSVTSVTKSSSEVTEFISKLSQLCP
EENLEKLIPCLAGSDPFYVERNHVDLEAGLRYLASLPSHVLKHDHVKKFFSSSSPTQQLQ
SPSPGNPSLPKVGAVMGVSGRPVCGVAGIPSSQSGAQHHLQHSASAAAALPHCSHAGGAG
SALAYRAQVDAPPAILMPSSLQAPQPQEQNGILDWLRKLRLHKYYPVFKQLTMEKFLSLT
EEDLNKFESLTMGAKKKLKTQLELEKEKSERRCLNSSAPTLVTSSGVARVPPTSHVGPVQ
AGRGGHAAELRVEVEPPTHQMPREGSSSEYSSSSSSPMGVQAREESSDSAEENDRRVDVH
LEGSDKEKPMMLLSHFPSSSARPTAQVLPVQNEAGCGPAGHHPLPPQLLPTASHLAPIRM
LSAVHKSDRGGADGKLLSSSVHSLLSLEERGKGPGPRSGIKVDKSFGSAVLDALPSSTPH
PPVQVLSGLSEGSSVSPTVSFGPRAKVVHAATLDRVLKTAQQPALAVETSTAATGTPSTV
LHVARPPIKLLLSSSVPADAAVSGQTSCPNNVQISVPPAIINPRTALYTANTKVAFSAVS
SVPVGPLQGGFCANSNTASSSSHPSTSFASAATLPSCPAPSSSPALSSAPESSFYSGGGS
AGNIPSSSQSHHHHHHHQQPPAPPAPAPPPPGCMVCTSCGCSGSCGSSGLTVSYASYFQH
PFSGPSMFTFPFLPFSPVCSNGYVSPQQYGGGSTFPVVHAPYSGSVTPDPVLGGQSTFAV
PPMQNFMAGTAGVYQTQGLVGSSNGSNHKKSGNLSCYNCGATGHRAQDCKQPSMDFNRQG
K
Download sequence
Identical sequences ENSSTOP00000005523 ENSSTOP00000005523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]