SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000006058 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000006058
Domain Number 1 Region: 4-125
Classification Level Classification E-value
Superfamily Hormone receptor domain 4.32e-26
Family Hormone receptor domain 0.00045
Further Details:      
 
Domain Number 2 Region: 115-384
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000000101
Family Rhodopsin-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000006058   Gene: ENSSTOG00000006773   Transcript: ENSSTOT00000006774
Sequence length 425
Comment pep:known_by_projection scaffold:spetri2:JH393279.1:50867893:50916107:1 gene:ENSSTOG00000006773 transcript:ENSSTOT00000006774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GALPQLCDVLRLLQEEQDQCLQELSKDRREDVSPQLPVPGCEGLWDNMSCWPSSAPGHTV
EVECPRFLQMLTSRNGSLFRNCTPDGWSETFPRPDLACGVNVNDSSNERRHAYLLKLKVM
YTVGYSSSLVMLLVALSILCALRRLHCTRNYIHMHLFVSFILRALSNFIKDAVLFSSDDV
TYCDTHRVGCKLVMIFFQYCIMANYAWLLVEGLYLHTLLVISFFSERKCLQGFIALGWGS
PAVFVASWAITRHFLEDIGCWDINANASIWWVIRGPVILSILINFILFINILRILMRKLR
TQETGGNEVNQYKRLAKSTLLLIPLFGVHYIVFAFSPEDAMEVQLFFELALGSFQGLVVA
ILYCFLNGEVQLEVQKKWRQWNLQGFPLRPVALSLSFSNGTSGPTHGTKGSPSEQSRGIC
RASII
Download sequence
Identical sequences ENSSTOP00000006058 ENSSTOP00000006058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]