SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000008274 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000008274
Domain Number 1 Region: 303-360
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 68-130
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.75e-22
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 3 Region: 415-472
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-21
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 4 Region: 359-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.32e-21
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 5 Region: 265-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.67e-19
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 6 Region: 457-509
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.67e-18
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000008274
Domain Number - Region: 235-276
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00108
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number - Region: 3-37
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.00417
Family SCAN domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000008274   Gene: ENSSTOG00000009229   Transcript: ENSSTOT00000009224
Sequence length 522
Comment pep:known_by_projection scaffold:spetri2:JH393284.1:22198418:22237584:1 gene:ENSSTOG00000009229 transcript:ENSSTOT00000009224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQQLLITLPTKASTWVKLHHPRKAKEGAPLWEDVTKIFEAEALPSQQVDESQGESCKDE
MTPGLLTAGSQELLTFKDVSVDFTQEEWGQLALDHQNLYREVMLENYGNLVSVGYQLCKP
VVISQLEKGEEPWLTEKKISGGSCSDSKSKTETNESTAKNDISQEHLYHDIMMERFIRDD
IIYSTLKKVSRYDDVLEKHQETCGRNVRQAILTHKKRVQDVHKYGEIIVSSNILEQKHHK
CDTPRKRKKYKLDLINHPISCIRAKIYECNICEKMFKQPNHLTEHMRIHTGEKPFRCKEC
GRAFSQSASLNTHQRIHTGEKPFECEECGKAFRHRSSLNQHHRTHTGEKPYVCDKCQKAF
SQNISLTQHLKTHSGEKPFTCNECGKTFRQIRHLSEHVRIHTGEKPYACTACCKTFSHRA
YLTHHQRIHTGERPYKCKECGKAFRQRIHLNNHKTVHTGVKAYECNRCGKAYRHDSSFKK
HQRHHTGEKPYECNECGKSFSYNSSLSRHHEIHRRNAFRSNV
Download sequence
Identical sequences ENSSTOP00000008274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]