SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000008489 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000008489
Domain Number 1 Region: 493-731
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000000000995
Family Protein kinases, catalytic subunit 0.01
Further Details:      
 
Domain Number 2 Region: 43-70
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000249
Family CCCH zinc finger 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000008489   Gene: ENSSTOG00000009453   Transcript: ENSSTOT00000009464
Sequence length 881
Comment pep:known_by_projection scaffold:spetri2:JH393282.1:23297850:23431294:1 gene:ENSSTOG00000009453 transcript:ENSSTOT00000009464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NSGGGLPPPSAAASPSSSSLAAAVAVVAPPGVGGVPGGAAAGVKLKYCRYYAKDKTCFYG
EECQFLHEDPAAGAAPSLGLHSNSVPLALAGAPVAGFPPGAVPGGGAGPPPGPKKPDLGG
PGPGATAGGGGSGGGLDVPGMDGGALTDTSLTDSFFSTSFIGVNGFGSPVETKYPLMQRM
TNSSSSPSLLNDSAKPYAGHDALSSPASSLFNDFGALNISQRRKPRKYRLGMLEERLVPM
GSKARKAKNPIGCLADRCKSGVPINMVWWNRVTENNLQTPNPTASEFIPKGGSTSRLSNV
SQSNMSAFSQVFSHPSMGSPATAGLAPGMSLSAGSSPLHSPKITPHTSPAPRRRSHTPNP
ASYMVPSSASTPVNNAVSQTPSSGQVIQKETVGGTTYFYTDTTPAPVTGMVFPNYHIYPP
TAPHVAYMQPKANAPSFFMADELRQELINRHLITMAQIDQADMPAVPTEVDSYHSLFPLE
PLPPPNRIQKSSNFGYITSCYKAVNSKDDLPYCLRRIHGFRLVNTKCMVLVDMWKKIQHS
NIVTLREVFTTKAFSEPSLVFAYDFHAGGETMMSRHFNDPNADSYFTKRKWGQHDGPLPR
QHAGLLPESLIWAYIVQLSSALRTIHTAGLACRVMDPTKILITGKTRLRVNCVGVFDVLT
FDNSQNNNPLALMAQYQQADLISLGKVVLALACNSLAGIQRENLQKAMELVTINYSSDLK
NLILYLLTDQNRMRSVNDIMPMIGARFYTQLDAAQMRNDVIEEDLAKEVQNGRLFRLLAK
LGTINERPEFQKDPTWSETGDRYLLKLFRDHLFHQVTEAGAPWIDLSHIISCLNKLDAGV
PEKISLISRDEKSVLVVTYSDLKRCFENTFQELIAAANGQL
Download sequence
Identical sequences ENSSTOP00000008489 ENSSTOP00000008489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]