SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000009157 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000009157
Domain Number 1 Region: 1-46
Classification Level Classification E-value
Superfamily Elafin-like 0.000000000379
Family Elafin-like 0.0016
Further Details:      
 
Domain Number 2 Region: 91-137
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000183
Family Elafin-like 0.0015
Further Details:      
 
Domain Number 3 Region: 47-90
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000602
Family Elafin-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000009157   Gene: ENSSTOG00000010208   Transcript: ENSSTOT00000010207
Sequence length 139
Comment pep:known_by_projection scaffold:spetri2:JH393324.1:7377455:7381900:1 gene:ENSSTOG00000010208 transcript:ENSSTOT00000010207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KPGECPRERLFCDVMRPDLCKSDFNCPDYMKCCTFACGRKCMDPYEVKKGQCPLFPYTSR
MECPKPCKNDMDCLMTEKCCDSRCGFVCANLWQVKPGFCPRMPQMCKKISKPMCLQDSDC
PEGEKCCSRCGLMCLAPWK
Download sequence
Identical sequences ENSSTOP00000009157 ENSSTOP00000009157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]