SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000009699 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000009699
Domain Number 1 Region: 185-390
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-54
Family DBL homology domain (DH-domain) 0.0000000125
Further Details:      
 
Domain Number 2 Region: 2-233
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.41e-39
Family Calponin-homology domain, CH-domain 0.0036
Further Details:      
 
Domain Number 3 Region: 377-539
Classification Level Classification E-value
Superfamily PH domain-like 3.07e-32
Family Pleckstrin-homology domain (PH domain) 0.0056
Further Details:      
 
Domain Number 4 Region: 664-765,809-835
Classification Level Classification E-value
Superfamily SH2 domain 1.49e-26
Family SH2 domain 0.0006
Further Details:      
 
Domain Number 5 Region: 590-672
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000249
Family SH3-domain 0.0000266
Further Details:      
 
Domain Number 6 Region: 777-823
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000025
Family SH3-domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000009699   Gene: ENSSTOG00000010806   Transcript: ENSSTOT00000010810
Sequence length 843
Comment pep:known_by_projection scaffold:spetri2:JH393398.1:4058343:4107134:1 gene:ENSSTOG00000010806 transcript:ENSSTOT00000010810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELWRQCTHWLIQCRVLPPSHRVTWEGAQVCELAQALRDGVLLCQLLNNLLPQAINLREV
NLRPQMSQFLCLKNIRTFLSTCGEKFGLKRSELFEPFDLFDVQDFGKVICTLSALSWTPI
AQNKGIIGVRGVPGLGAGGPPDSEPHSDTAEEDEDLYDCVENEEAEGDEIYEDLMRSEPV
PMLPKMTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFMKPLQRFLTPQDMENIFVNIEDL
LRVHTLFLKEMKEALATPGSPTLYQVFIKYKERFLVYGRYCSQVESASKHLDQVATARED
VQMKLEECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHTQDTVEKENLRLALDAM
RDLAQCVNEVKRDNETLRQITHFQLSIENLGQSLANFGRPKIDGELKITSVERRTKTDRY
AFLLDKALLICKRRGDSYDLKVFVNLHSFQIRDDSSGDRENKKWSHMFLLIEDQGAQGYE
LFFKTRELKKKWMEQFEMAISNIYPENAAANGHDFQMFSFEETTSCKACQMLLRGTFYQG
YRCSRCRAPAHKECLGRVPPCGRHGQVDCAGTMRKDKLHRRAQDRKRSELGLPKMEVFQE
YYGLPPPPGAFGPFLRLSPGDIVELTKAEAEQNWWEGRNTATNEVGWFPCHRVKPYVHGP
PQDLSVHLWYAGPMERAGAENILTNRSDGTFLVRQRVKDTAEFAISIKYNVEVKHIKIMT
SEGLYRITEKKAFRGLVELVEFYQQNSLKDCFKSLDTTLQFPYKEPERRAISKPAAGSAK
YFGTAKARYDFCARDRSELSLKEGDIIKILNKRGQQGWWRGEIYGRVGWFPSNYVEEDYS
EYC
Download sequence
Identical sequences ENSSTOP00000009699 ENSSTOP00000009699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]