SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000010172 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000010172
Domain Number 1 Region: 499-740
Classification Level Classification E-value
Superfamily vWA-like 1.56e-76
Family Trunk domain of Sec23/24 0.00000539
Further Details:      
 
Domain Number 2 Region: 741-833
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 3.79e-39
Family beta-sandwich domain of Sec23/24 0.00071
Further Details:      
 
Domain Number 3 Region: 942-1090
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 2.3e-35
Family C-terminal, gelsolin-like domain of Sec23/24 0.001
Further Details:      
 
Domain Number 4 Region: 272-465
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 2.28e-29
Family beta-sandwich domain of Sec23/24 0.0018
Further Details:      
 
Domain Number 5 Region: 837-938
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 4.45e-26
Family Helical domain of Sec23/24 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000010172   Gene: ENSSTOG00000011330   Transcript: ENSSTOT00000011337
Sequence length 1091
Comment pep:known_by_projection scaffold:spetri2:JH393457.1:612984:688552:-1 gene:ENSSTOG00000011330 transcript:ENSSTOT00000011337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQPGIPASGGSPTGLQAQNGASSTSGSPYTNGPVQNALMSSQLSVSQGYNFQLPGSYPH
LIPAKTLNPVSGQSNYGGSQGSGQTINRPPVASNTVTPSLHSGPVPRMPLPASQNPAAAP
MPSGSFLPGANIPPHSNWQYNYPPTGSQTNHCPRASSQPTALGSTNLTTNHQYVSSGDPS
LQNSFIKSGSSLPLRNPPLPTTFQPGTPHGPPPPRGPPPVRDPMLQNSHRPAPQPSFNSA
VNQEGITSNANNGSMAVHSSYDEIEGGGFLATPQLINKNPKMSRSVGYAYPSLPPGYQNT
TPPSATGIPPSSLNYPSGPQAFTQTPLGANHLTTSMSGLSLHPEGLRVINLLQERNMLPS
TPLQPPVPNLHEDIQKLNCNPELFRCTLTSIPQTQALLNKAKLPLGLLLHPFKDLVQLPV
VTSSTIVRCRSCRTYINPFVSFLDQRRWKCNLCYRVNDVPEEFMYNPLTRVYGEPHRRPE
VQNATIEFMAPSEYMLRPPQPPVYLFVFDVSHNAVETGYLNSVCQSLLDNLDLLPGNTRT
KIGFITFDSTIHFYSLQEGLSQPQMLIVSDIEDVFIPMPENLLVNLNESKELVQELLKTL
PQMFTKTLETQSALGPALQAAFKLMSPTGGRMSVFQTQLPTLGVGALKPREEPNQKSSAK
EIHLTPSTDFYKKLALDCSGQQIAVDLFLLSGQYSDLASLGCISRYSAGSVYYYPSYHHQ
HNPVQVQKLQKELQRYLTRKIGFEAVMRIRCTKGLSIHTFHGNFFVRSTDLLSLPNVNPD
AGYAVQMSVEESLTDTQLVSFQSALLYTSSKGERRIRVHTLCLPVVSTLNEIFLGADVQA
ISGLLANMAVDRSMTASLSDARDALVNAVIDSLAAYRSSVLSNQQPGLMVPFSLRLFPLF
VLALLKQKSFQTGTNARLDERIFAMCQVKNQPLVYLMLTTHPTLYRVDNLSDEGALNIND
RTIPQPPILQLSVEKLSRDGAFLMDAGSVLMLWVGKNCAQNFLTQVLGVQNYASIPQTMT
DLPELDTPESARTVAFISWLREQRPFFPVLYIIRDESPMKANFLQNMVEDRTESALSYYE
FLLHIQQQVNK
Download sequence
Identical sequences I3MH50
ENSSTOP00000010172 ENSSTOP00000010172 XP_005335794.1.77405 XP_021589237.1.77405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]