SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000010805 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000010805
Domain Number 1 Region: 735-828
Classification Level Classification E-value
Superfamily Immunoglobulin 1.59e-23
Family I set domains 0.0077
Further Details:      
 
Domain Number 2 Region: 1023-1117
Classification Level Classification E-value
Superfamily Immunoglobulin 5.5e-23
Family I set domains 0.0042
Further Details:      
 
Domain Number 3 Region: 831-925
Classification Level Classification E-value
Superfamily Immunoglobulin 6.39e-21
Family I set domains 0.0064
Further Details:      
 
Domain Number 4 Region: 97-191
Classification Level Classification E-value
Superfamily Immunoglobulin 2.72e-20
Family I set domains 0.01
Further Details:      
 
Domain Number 5 Region: 288-382
Classification Level Classification E-value
Superfamily Immunoglobulin 8.97e-19
Family I set domains 0.016
Further Details:      
 
Domain Number 6 Region: 927-1021
Classification Level Classification E-value
Superfamily Immunoglobulin 3.16e-18
Family I set domains 0.003
Further Details:      
 
Domain Number 7 Region: 1119-1206
Classification Level Classification E-value
Superfamily Immunoglobulin 5.14e-18
Family I set domains 0.0062
Further Details:      
 
Domain Number 8 Region: 642-732
Classification Level Classification E-value
Superfamily Immunoglobulin 1.58e-16
Family I set domains 0.0061
Further Details:      
 
Domain Number 9 Region: 192-286
Classification Level Classification E-value
Superfamily Immunoglobulin 1.99e-16
Family I set domains 0.011
Further Details:      
 
Domain Number 10 Region: 4-93
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000101
Family I set domains 0.0098
Further Details:      
 
Domain Number 11 Region: 381-464
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000164
Family I set domains 0.021
Further Details:      
 
Domain Number 12 Region: 548-639
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000424
Family I set domains 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000010805   Gene: ENSSTOG00000012034   Transcript: ENSSTOT00000012047
Sequence length 1295
Comment pep:known_by_projection scaffold:spetri2:JH393289.1:406121:418139:1 gene:ENSSTOG00000012034 transcript:ENSSTOT00000012047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GMEPQPDLWIESNYPQAPWENITLWCRSPSRISSKFLLLKDKTQMTWIRPSYKTFQVSFF
LGALTESNTGLYRCCYWKETGWSKPSKVLELEAPGQLPKPIFWIQAETPPLPGCNVNILC
HGWLQDLVFMLFKEGYAEPVDYQVPTGTMAIFSIDNMTPENEGVYICRTHIQMLPTLWSE
PSNPLKLVVAGLYPKPTLTAYPGPMMAPGESLNLRCQGPIYGMTFALMKLEDLEKSFYHK
KPIKNEAHFFFQSLKSQDSGHYLCFYYDGSYRGSLLSDILKIWVTDSFPKTRLLAQPSPV
VQMGQNVSLRCQGQVDGVGLALYKKGEDKPLQLLDATSINDTKSFFLNNVTYSDSGIYSC
HYLLPWKTSIKMATHNSVELVVVAWPSTVFKLGKAITLQCRVSHPVLEFSLEWEEKEKFQ
KFSADGDFIITNVEGKGIGTYSCSYRVEAHPNIWSHRSEPLKLMGPAGFLTWNYVLNEAI
RLSLIVQLVALLVVVLWIRWKCRRLRIREAWLLGTAQGVTMLFIITALLCCGRMVSLTLL
FLEIIMPTPKPELWAETNFPLAPWKNLTLWCRSPSGSTKEFVLLKDGTGWIATRPASEQV
RAAFPLGALTQSHTGSYHCHSWEEMAVSEPSEVLELVGTDILPKPVISAAPPVWGRELQI
RCKGWLAGMSFALYKEGEQEPVQQLGAVGREAFFTIQRMEDKDEGNYSCRMHTEKRPFKW
SEPSEPLELVIKEMYSKPFFKTLTSPVVTPGARVTFNCSTPHQHMTFILYKDGNEIAASD
RSWANPGATTANFVIDSVGIGDGGNYSCRYYDFAIWSEPSDPVELVVTEFYPKPTLLAQP
GPVVLPGKNVTLRCQGIFQGMRFALLQEGTQAPIQFQSASGNSADFLLHTVSTGDSGNYS
CIYYETTMSNRGSYLSMPLMIWVTDTFPKPWLFAVPSSVVAIGQNVTLWCQGPVHGVGYI
LHKEVGPTSMQLWGSTSNDGAFPITNISGASLGRYSCYYHPDWTSSIKIQPSNTLELIVT
GLLPKPSLLVQPGPMVAPGENITLQCQGELPDSTFVLLKEGSQEPLEQQRPNGYRADFWM
PVVRGEDSGIYSCVYYLDSAPLAASNHSDSLEIWVTDKPPKPSLAAWPSTVFQLGKDITL
QCRGPLPGVEFVLEQEGEEAPQQFSEDGDFIINNMEGKGIGNYTCSYRLQAFPDIWSEPS
DSLELVGAAGPAAQECTVGNIVRSSLIVVVVVALGVVLAIEWKKWPRLRTRGSETDGRDQ
TIVLEECNQEGEPDTTTNSPSSTSQGISVELPVPI
Download sequence
Identical sequences ENSSTOP00000010805 ENSSTOP00000010805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]