SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000011366 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000011366
Domain Number 1 Region: 714-966
Classification Level Classification E-value
Superfamily RNI-like 2.55e-48
Family 28-residue LRR 0.00015
Further Details:      
 
Domain Number 2 Region: 1-89
Classification Level Classification E-value
Superfamily DEATH domain 8.71e-19
Family Pyrin domain, PYD 0.0000534
Further Details:      
 
Domain Number 3 Region: 1376-1458
Classification Level Classification E-value
Superfamily DEATH domain 5.18e-16
Family Caspase recruitment domain, CARD 0.024
Further Details:      
 
Domain Number 4 Region: 322-513
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000109
Family G proteins 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000011366   Gene: ENSSTOG00000012657   Transcript: ENSSTOT00000012686
Sequence length 1472
Comment pep:known_by_projection scaffold:spetri2:JH393487.1:2248786:2289407:1 gene:ENSSTOG00000012657 transcript:ENSSTOT00000012686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARGTQDQLAHYLELLPKEELKEFQLRLSNKTLFGCPSGVTPAQPEKASGTEVASQLVAQ
YGEQRAWDLAFHTWEQMGLSLLCAQAQAQTTLTSSNSSLIIGSPKTPAMESPSWPTSTEV
LKFWNFPCTGSTRESKRIFPVTPSHIQKGNPPLFLHRAPSSSTDQESPSQESPNAPTSTV
LGGWEPPSQTNAEPRHQGAPDTEKLLAETSGNYYGEKEKKEERRETGNEIWMELTNTYLV
RHLSIFRIRERYQNQRREKLRHAQSWKNDNMHQKFTQLLLLQKPHSRGKNPLARKSWHRN
AVEEQGHLIEIRELFGPGPGFQKEPHIVILHGAPGIGKSTLARQVKGAWEEGQLYRDRFQ
HVFYFSCRELAQCKLVSLAELISEDGTAPTAPIRQILSQPEQLLFILDGIDEPKWVLENQ
SPELCVHWSQSQPVHALLGGLLGKAILPEASLLLTSRTTDLQKLIPSLKQPRWVEVLGFS
ESGRKEYFYKYFTDESQANRAFTMLKSNPELLTLCLMPLVSWMVCTYLKENMKLGKVLPP
TIQTLTSLYMHYLFQAFPAPHLGTQLKDFCSLAAEGLWQRKTVFSAGDLRKHELNEAIIT
IFLKRGVLRKGPDSLTYSFIHLCFQEFFAAMSYALRDKEERSQSPDGLGGMEELLDVYGR
NNLFGAPTVRFLFGLLSDHWSRATEEPFTFQLYPERKWELLQWVEAKSPPGKPHSLEFLH
CLYETQDEEFLMQAMDCFQRTRMYVQTDMELLVFIFCIKFCGHVKRLQLNESPQKGQGWR
PPGVVLSRWVPITDNSWQVLFSTLRVSGGLRELDLSGNSLSHSAVQNLRRTLRPPLCYLE
TLRLASCGLTAESCKDLAIGLSTSETLTELELNFNLLTDSGAQHLFQSLSQRYCKLQRLR
LVSCGLTSSCCQDLASALSVSPRLLELDLQQNDLGDHGVRLLYKGLKHPACQLTLLWLDY
IPLSDQVREELKALEEEIPRLLISSRWKPSVMIPTGDPDEGQMGENMSSLKRQRPQSGHA
ENSDTSGIVVVVVVVVLVPKIEPRGHSAKESSPQVAQVEPFHLSSHASAEDLHMEPLGTE
DNFWGPTGPVATEMVDKEKSLYRVHFPMAGSYCWSNTGLTFVVRRAVTIEIEFCAWDQFL
GNTIPPQSWMVAGPLFDIKAEQGAVAAVYLPHFVALQEGPVDISLFHVAHFKEEGMLLEK
PSRVEPHYAVLEDPSFSPMGILLRMIPTALCFIPITSTTLLYHQLHPKEITSFHLYLIPS
DCSIQKAIDDEEKKFQFVRIHKPPPVTPLYLGSRYTVSASRKLEIIPKELELCYRSPREP
QLFSEFYIGHLGSGIRLQIKNKKGGTVVWKAQLKPGDLRPAATPIPPVTKDALGSLHFVD
RHREQLVARVTSVDPVLDKLHGQVLSEEQYEKVRAETTKPGQMRKLFSFSRSWDWACKDQ
LYRALKEIHPHLIVELWEKWDNSISGNVPLKL
Download sequence
Identical sequences ENSSTOP00000011366 ENSSTOP00000011366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]