SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000011756 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000011756
Domain Number 1 Region: 35-126
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.69e-37
Family SCAN domain 0.0000471
Further Details:      
 
Domain Number 2 Region: 472-529
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.34e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 3 Region: 585-642
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.5e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 631-683
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.27e-18
Family Classic zinc finger, C2H2 0.0023
Further Details:      
 
Domain Number 5 Region: 435-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.67e-18
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 6 Region: 514-559
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000686
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 7 Region: 212-266
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000000209
Family KRAB domain (Kruppel-associated box) 0.0051
Further Details:      
 
Domain Number 8 Region: 376-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000524
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000011756   Gene: ENSSTOG00000013118   Transcript: ENSSTOT00000013115
Sequence length 685
Comment pep:known_by_projection scaffold:spetri2:JH393504.1:948889:954699:-1 gene:ENSSTOG00000013118 transcript:ENSSTOT00000013115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMASVPGSQEREGLLIVKLEEDCAWSQELPPPDPGPSQEASHLRFRRFRFQEAAGPREAL
SRLQELCHGWLRPEMRTKEQILELLVLEQFLTILPQEIQSRVQELHPESGEEAVTLVEDM
QRELGRLRQQVTNQGRGTEVLLEEPLPLETAGESPSFKLEPMETERSPGPRLQELLGPSP
KRDPQAVKDRALSTPWLSLFPPEGNMEDKEMTGPQLPESIEDVAMYISQEEWGHQDPNKR
VLSRDTVQESYENVDSLESHIPSQEALNTQVEQGGKPWDPSVQSCKEGVSPRSAAPGEEK
FENPEGSSPSVSLENTHPQVLFPGQARGEVPWSPELGRPHDRAEGHWEPPPEDRTEQSLA
GATGCRELVRPKELQPKKLHLCPLCGKNFSNNSNLIRHQRIHAAEKLCMGVECGEVFGGH
PHFMSLHRAHLGEEAHKCLECGKCFSQNTHLTRHQRTHTGEKPYQCSVCGKSFSCNSNLH
RHQRTHTGEKPYKCPECGEIFAHSSNLLRHQRIHTGERPYKCAECGKSFSRSSHLVIHER
THEKERLDPFSECGEAMSDSAPFLTNHGAHRAEKKLFECLTCGKSFRQGMHLTRHQRTHT
GEKPYKCTLCGENFSHRSNLIRHQRIHTGEKPYTCHECGDSFSHSSNRIRHLRTHTGERP
YKCSECGESFSRSSRLMSHQRTHTG
Download sequence
Identical sequences ENSSTOP00000011756 ENSSTOP00000011756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]