SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000013880 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000013880
Domain Number 1 Region: 33-113
Classification Level Classification E-value
Superfamily Hormone receptor domain 7.32e-29
Family Hormone receptor domain 0.00000454
Further Details:      
 
Domain Number 2 Region: 110-378
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000229
Family Rhodopsin-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000013880   Gene: ENSSTOG00000015502   Transcript: ENSSTOT00000015505
Sequence length 411
Comment pep:known_by_projection scaffold:spetri2:JH393288.1:6902634:6930686:-1 gene:ENSSTOG00000015502 transcript:ENSSTOT00000015505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAALLHNLLEANCSLALAEELLLDGWGPSLDPEGPYSYCNTTLDQIGTCWPRSAAGALV
ERPCPEYFNGIKYNTTRNAYRECLDNGTWASKINYSQCEPILDDKQRKYDLHYRIALVVN
YLGHCVSVAALVAAFLLFLTLRSIRCLRNVIHWNLITTFILRNVMWFLLQLIDHEVHESN
EVWCRCITTIFNYFVVTNFFWMFVEGCYLHTAIVMTYSTERLRKWLFLFIGWCIPCPIII
AWAVGKLYYENEQCWFGKEPGDLVDYIYQGPIILVLLINFVFLFNIVRILMTKLRASTTS
ETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDLSQIVFIYFNSFLQSFQGFFVSVFYC
FFNGEVRSAVRKRWHRWQDHHSLRVPVARAMSIPTSPTRISFHSIKQTAAV
Download sequence
Identical sequences I3MPU6
ENSSTOP00000013880 ENSSTOP00000013880 XP_005319222.1.77405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]