SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000013900 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000013900
Domain Number 1 Region: 14-100
Classification Level Classification E-value
Superfamily PH domain-like 0.00000836
Family Pleckstrin-homology domain (PH domain) 0.0000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000013900   Gene: ENSSTOG00000015521   Transcript: ENSSTOT00000015528
Sequence length 103
Comment pep:novel scaffold:spetri2:JH393288.1:3547222:3566017:-1 gene:ENSSTOG00000015521 transcript:ENSSTOT00000015528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNPSSTSSPYPLPEEIRNLLADVETFLADTLRGENLSKKAKEKRESLIKKIKDVKYTYL
HEFQDKGDTEEGEEYDDPFAGPPDSISLASERYDKDDEAPSDG
Download sequence
Identical sequences ENSSTOP00000013900 ENSSTOP00000013900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]