SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000014829 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000014829
Domain Number 1 Region: 619-669
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000458
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 656-702
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000154
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 3 Region: 136-166
Classification Level Classification E-value
Superfamily SET domain 0.00000576
Family Histone lysine methyltransferases 0.057
Further Details:      
 
Domain Number 4 Region: 178-206
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000854
Family C2HC finger 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000014829   Gene: ENSSTOG00000016567   Transcript: ENSSTOT00000016570
Sequence length 753
Comment pep:known_by_projection scaffold:spetri2:JH393461.1:1200089:1207869:1 gene:ENSSTOG00000016567 transcript:ENSSTOT00000016570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPDRVTPQAEDARRGAAPWLARGWLCHLRPEEDPARPSACLAAVATMHGTVRAPATSVSA
DCCIPAGLRLGPVPGTFKLGKYLSDRREPGPKKKVRMVRGELVDESGGSPLEWIGLIRAA
RNSQEQTLEAIADLPGGQIFYRALRDVQPGEELTVWYSNSLAQWFDIPTTATPTHDEKGE
ERYICWYCWRTFRYPNSLKAHLRFHCVLSGAGARAFLHHEHAARQGAAPADGLDLSPKPS
AADFAVPAQAGTLRSQSQAAQTPQACGARESIKREASSVLSATSPPPGKWGLPKKGKEQS
RAHGHFLGIVGGSPPGSGGLAFYPGVRSAFKPAGLARAAAASHGDPYREEGGGKQGAGLA
LGRLLGGGRAGGRPGSGENPAAGGAGHHHHHHAHHHHPKCLLAGDPPPPPPPGLPCSGPL
RGFPLLPGHPEEASAFKHVERAPPATAALPGARFAQLPPAPGLPLERCALPPLDAGGLKP
YPGGECSHLSTVMPAFTVYNGELLYGSPAAAAYYPLKLHFGGLLKYPESISYLXXXXXXX
XXXXXXXXXXXXLSPAELGSLASIDREIAMHTQQLSEMAAGKGRGRLDSGTLPPAVMTAG
GGGSGGSSGGGAGKPKTGHLCLYCGKLYSRKYGLKIHMRTHTGYKPLKCKVCLRPFGDPS
NLNKHIRLHAEGNTPYRCEFCGKVLVRRRDLERHVKSRHPGQTLLAKAADGPGAEPGYPL
EPGDPKSDDSDVDVCFTDDQSDAEAGGGLERDS
Download sequence
Identical sequences ENSSTOP00000014829 ENSSTOP00000014829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]