SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000015431 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000015431
Domain Number 1 Region: 388-625
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.53e-38
Family Calponin-homology domain, CH-domain 0.0000792
Further Details:      
 
Domain Number 2 Region: 86-241,387-436
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.18e-17
Family FAD/NAD-linked reductases, N-terminal and central domains 0.058
Further Details:      
 
Domain Number 3 Region: 756-789
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000052
Family LIM domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000015431   Gene: ENSSTOG00000024873   Transcript: ENSSTOT00000027320
Sequence length 809
Comment pep:novel scaffold:spetri2:JH393617.1:768574:969309:-1 gene:ENSSTOG00000024873 transcript:ENSSTOT00000027320 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEKKHETTNQAHVLFDRFVQATTCKGTLKAFQELCDHLELKPKDYHSFYHKLKSKLNYW
KAKALWAKLDKRGSHKDYKKGKACTNTKCLIIGAGPCGLRTAIDLSLLGAKVVVIEKRDA
FSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGAIDHISIRQLQLILLKVALILGIEIHVN
VEFQGLVQPPEDQENERIGWRALVHPKTHPVSEYEFEVIIGGDGRRNTLEGFRRKEFRGK
LAIAITANFINRNTTAEAKVEEISGVAFIFNQKFFQELREATGIDLENIVYYKDDTHYFV
MTAKKQSLLDKGVILHDYADTELLLSRENVDQEALLNYAREAADFSTQQQLPSLDFAINH
YGQPDVAMFDFTCMYASENAALVREQNGHQLLVALVGDSLLEPFWPMGTGIARGFLAAMD
SAWMVRSWSLGTSPLEVLAERESIYRLLPQTTPENVSKNFSQYSIDPVTRYPNINVNFLR
PSQVRHLYDTGETKDIHLEMENLVNSRTTPKLTRNESVARSSKLLSWCQRQTDGYAGVNV
TDLTMSWKSGLALCAIIHRYRPDLIDFDSLDEQNVEKNNQLAFDIAEKELGISPIMTGKD
MASVGEPDKLSMVMYLTQFYEMFKDSLSSTDTLDLNAEEKAVLIASTKSPISFLSKLGQT
ISRKRSPKDKKEKDLDGAGKRRKTSQSEEEETPRGYRGERPTLVSTLTDRRMDVAVGNQN
KVKYMATQLLAKFEENAPAQTTGIRRQGSMKKEFPQNLGGSDTCYFCQKRVYVMERLSAE
GKFFHRSCFKCDYCATTLRLSAYAYDIED
Download sequence
Identical sequences ENSSTOP00000015431

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]