SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000015503 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000015503
Domain Number 1 Region: 407-542
Classification Level Classification E-value
Superfamily TIMP-like 7.53e-32
Family Netrin-like domain (NTR/C345C module) 0.03
Further Details:      
 
Domain Number 2 Region: 184-279
Classification Level Classification E-value
Superfamily Immunoglobulin 4.64e-21
Family I set domains 0.041
Further Details:      
 
Domain Number 3 Region: 360-412
Classification Level Classification E-value
Superfamily BPTI-like 1.12e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0022
Further Details:      
 
Domain Number 4 Region: 301-355
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000000000115
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.017
Further Details:      
 
Domain Number 5 Region: 98-148
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000166
Family Ovomucoid domain III-like 0.033
Further Details:      
 
Domain Number 6 Region: 12-63
Classification Level Classification E-value
Superfamily Elafin-like 0.000000144
Family Elafin-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000015503   Gene: ENSSTOG00000021096   Transcript: ENSSTOT00000027226
Sequence length 551
Comment pep:known_by_projection scaffold:spetri2:JH393300.1:10898688:11097239:-1 gene:ENSSTOG00000021096 transcript:ENSSTOT00000027226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRVSPPGLALPPIRYSHAGICPNDMNPNLWVDAQSTCKRECETDQECETYEKCCPNVCGT
KSCVAARYMDVRGKKGPVGMPKEATCDHFMCLQQGSECDIWDGQPVCKCKDRCEKEPSFT
CASDGLTYYNRCYMDAEACSRGITLAVVTCRYHFTWPNTSPLPPETTVHPTTASPETPGL
DMAAPALLNHPVHQSVTVGETVSFLCDVVGRPRPEITWEKQLEDRENVVMRPNHVRGNVV
VTNIAQLVIYNAQPQDAGIYTCTARNAAGVLRADFPLSVVRGGQAVATSESSPNGTAFPV
AECLKPPDSEDCGEEQTRWHFDAQANNCLTFTFGHCHRNLNHFETYEACMVACMSGPLAV
CSLPALQGPCKAYAPRWAYNSQTSQCQSFVYGGCEGNGNNFESREACEESCPFPRGNQQC
RACKPRQKLVTSFCRSDFVILGRVSELTEEPDSGRALVTVDEVLKDEKMGLKFLGREPLE
VTLLHVDWACPCPNVTVGETPLIIMGEVDGGMAMLRPDSFVGASSSRRVRKLREVMHKKT
CDVLKEFLGLH
Download sequence
Identical sequences ENSSTOP00000015503 ENSSTOP00000015503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]