SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000015753 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000015753
Domain Number 1 Region: 19-477
Classification Level Classification E-value
Superfamily Sema domain 2.75e-126
Family Sema domain 0.0000314
Further Details:      
 
Domain Number 2 Region: 1321-1447,1642-1831
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.46e-51
Family p120GAP domain-like 0.033
Further Details:      
 
Domain Number 3 Region: 1010-1114
Classification Level Classification E-value
Superfamily E set domains 1.6e-16
Family E-set domains of sugar-utilizing enzymes 0.07
Further Details:      
 
Domain Number 4 Region: 923-1011
Classification Level Classification E-value
Superfamily E set domains 5.09e-16
Family Other IPT/TIG domains 0.029
Further Details:      
 
Domain Number 5 Region: 826-925
Classification Level Classification E-value
Superfamily E set domains 0.000000000000028
Family Other IPT/TIG domains 0.013
Further Details:      
 
Domain Number 6 Region: 477-522
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000196
Family Plexin repeat 0.0027
Further Details:      
 
Domain Number 7 Region: 1111-1201
Classification Level Classification E-value
Superfamily E set domains 0.000000532
Family E-set domains of sugar-utilizing enzymes 0.038
Further Details:      
 
Domain Number 8 Region: 779-811
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000288
Family Plexin repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000015753   Gene: ENSSTOG00000026715   Transcript: ENSSTOT00000023657
Sequence length 1861
Comment pep:known_by_projection scaffold:spetri2:JH393608.1:952410:989825:-1 gene:ENSSTOG00000026715 transcript:ENSSTOT00000023657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WVAAGSPRTDGTPPPAFRTFVASDWGLTHLVVHEQTGEVYVGAVNRIYKLSGNLTLLRAH
VTGPVEDNEKCYPPPSVQSCPHGLGSTDNVNKLLLLDYAANRLLACGSASQGICQFLRLD
DLFKLGEPHHRKEHYLSSVREAGSMAGVLIAGTPGQGQAKLFVGTPIDGKSEYFPTLSSR
RLMANEEDADMFGFVYQDEFVSSQLKIPSDTLSKFPAFDIYYVYSFRSEQFVYYLTLQLD
TQLTSPDAAGEHFFTSKIVRLCVDDPKFYSYVEFPIGCQQAGVEYRLVQDAYLSRPGRED
VLFTVFAQGQKNRVKPPKESALCLFTLRAIKEKIKERIQSCYRGEGKLSLPWLLNKELGC
INSPLQIDDDFCGQDFNQPLGGTVTIEGTPLFVDKDDGLTAVAAYDYRGRTVVFAGTRSG
RIRKILVDLANHGGRPALAYESVVAQEGSPILRDLVLSPNRQYLYAMTEKQVTRVPVESC
VQYASCELCLGSRDPHCGWCVLHSVCSRQDACERADEPQRFASDLLQCVQLTVQPRNVSV
TVSQVPLLLQAWNVPDLSAGVNCSFEDFTESEGILDDGRIHCRSPSAREVAPITRGQGDQ
RVVKLYLKSKETGKKFASVDFVFYNCSVHQSCLSCVNGSFPCHWCKYRHVCTHNAADCAF
LEGRVNVSEDCPQILPSTQIYVPVGVVKPITLAARNLPQPQSGQRGYECLFHIPGSPARV
TALRFNSSSLQCQNSSYSYEGNDISDLPVNLSVVWNGNFVIDNPQNIQAHLYKCPALRES
CGLCLKADPRFECGWCVAERRCSLRHHCPADAPSAWMHARHGSSRCADPKILKLSPETGP
RQGGTRLTITGENLGLRFEDVRLGVRVGKVLCSPVESEYISAEQIVCEIGDASTVRAHDA
LVEVCVRDCSPHYRALSPKRFTFVTPTFYRVSPSRGPLSGGTWIGIEGSHLNAGSDVAVS
IGGRPCSFSWRNSREIRCLTPPGQSPGSAPVVININRAQLANPDVKYNYTEDPTILKIDP
AWSINSGGTLLTVTGTNLATVREPRIRAKYGGVERENSCMVYNDTTMVCRAPSVDNPTRS
PPELGERPDELGFVMDNVRALLVLNSSTFVYYPDPVLEPLSPTGLLELKPSSPLILKGRN
LLPPAPGNSRLNYTVLIGSTPCVLTVSETQLLCESPNLTGQHKVTVRAGGFEFSPGMLQV
YSDSLLTLPAIVGIGGGGGLLLLVIVAVLIAYKRKSRDADRTLKRLQLQMDNLESRVXXR
LATAFAELQTDIHELTNDLDGAGIPFLDYRTYAMRVLFPGIEDHPVLKEMEVQANVEKSL
TLFGQLLTKKHFLLTFIRTLEAQRSFSMRDRGNVASLIMTALQGEMEYATGVLKQLLSDL
IEKNLESKNHPKLLLRRTESVAEKMLTNWFTFLLYKFLKECAGEPLFMLYCAIKQQMEKG
PIDAITGEARYSLSEDKLIRQQIDYKTLTLNCVNPENENAPEVPVKGLNCDTVTQVKEKL
LDAVYKGVPYSQRPKAGDMDLEWRQGRMARIILQDEDVTTKIDNDWKRLNTLAHYQVTDG
SSVALVPKQTSAYNISNSSTFTKSLSRYESMLRTASSPDSLRSRTPMITPDLESGTKLWH
LVKNHDHLDQREGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETIFSTAHRGSALPLAI
KYMFDFLDEQADKHQIHDADVRHTWXXXXLPLRFWVNVIKNPQFVFDIHKNSITDACLSV
VAQTFMDSCSTSEHKLGKDSPSNKLLYAKDIPNYKSWVERYYADIAKMPAISDQDMSAYL
AEQSRLHLSQFNSMSALHEIYSYITKYKDEILAALEKDEQARRQRLRSKLEQVVDTMALS
S
Download sequence
Identical sequences ENSSTOP00000015753 ENSSTOP00000015753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]