SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000015842 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000015842
Domain Number 1 Region: 16-342
Classification Level Classification E-value
Superfamily SIS domain 5.38e-97
Family double-SIS domain 0.000000955
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000015842   Gene: ENSSTOG00000022873   Transcript: ENSSTOT00000029984
Sequence length 342
Comment pep:novel scaffold:spetri2:JH393301.1:13604144:13640534:-1 gene:ENSSTOG00000022873 transcript:ENSSTOT00000029984 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGRVNFDDYTVNLGGLKDHIKEIQRCRRLILIACGTSYHAGVATRQVLEELTELPVMVE
LASDFLDRNTPVFRDDVCFFISQSGETADTLMCLRYCKERGALTVGITNTVGSSISRETD
CGVHINAGPEVGVASTKAYTSQFVSLVMFALMMCDDRISMQERRKEIMLGLKRLPDLIKE
VLSMDDEIQKLATELYHQKSVLIMGRGYHYATCLEGALKIKEITYMHSEGILAGELKHGP
LALVDKLMPVIMIIMRDHTYAKCQNALQQVVARQGRPVVICDKEDTETIKNTKRTIKVPH
SVDCLQGILSVIPLQLLAFHLAVLRGYDVDFPRNLAKSVTVE
Download sequence
Identical sequences ENSSTOP00000015842 ENSSTOP00000015842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]