SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000016232 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000016232
Domain Number 1 Region: 46-135
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 7.32e-38
Family SCAN domain 0.0000629
Further Details:      
 
Domain Number 2 Region: 224-271
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00000000405
Family KRAB domain (Kruppel-associated box) 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000016232   Gene: ENSSTOG00000027612   Transcript: ENSSTOT00000025073
Sequence length 275
Comment pep:novel scaffold:spetri2:JH393505.1:1022528:1028907:-1 gene:ENSSTOG00000027612 transcript:ENSSTOT00000025073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTEGRGTLGLIPRSSVFQKQAGCLTVKQQSGNQTRGPSCSLLKNHPPVCEIFRLHFRQL
CYHEMSGPQEALSRLRELCRWWLMPEVHTKEQILELLVLEQFLSILPVELRTWVQLHHPE
SGEEAVAVVEDFQRHLSVQEEVSASAQKQEVHMEETTVLGTTEESPTSPLSGGSAPGAHL
EPPHDSGAHHLPNGHFAQLASIVPAHSQMGNSGDQVMATVLQMVKAQETATNEDLSVDCT
QKKWKGPAVRQRALYRNTVLENYSIMNSLGNDFLS
Download sequence
Identical sequences ENSSTOP00000016232 ENSSTOP00000016232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]