SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000016619 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000016619
Domain Number 1 Region: 72-119
Classification Level Classification E-value
Superfamily Elafin-like 0.000000000562
Family Elafin-like 0.00045
Further Details:      
 
Domain Number 2 Region: 29-72
Classification Level Classification E-value
Superfamily Elafin-like 0.00000000275
Family Elafin-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000016619   Gene: ENSSTOG00000020720   Transcript: ENSSTOT00000020468
Sequence length 121
Comment pep:known_by_projection scaffold:spetri2:JH393324.1:7418143:7422295:-1 gene:ENSSTOG00000020720 transcript:ENSSTOT00000020468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVPRLCALAAALLLGLLLLGLPPATGAGERAGVCPQLPADVNCTKECLSDSDCADYRKC
CHAGCGTVCSIPNEKPGSCPNVDLPQLGICQDQCQEDSQCTGPMKCCRNGCGKVSCVTPD
P
Download sequence
Identical sequences I3MWX4
ENSSTOP00000016619 ENSSTOP00000016619 XP_005325323.1.77405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]