SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000016966 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000016966
Domain Number 1 Region: 213-461
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.45e-58
Family Voltage-gated potassium channels 0.00046
Further Details:      
 
Domain Number 2 Region: 86-183
Classification Level Classification E-value
Superfamily POZ domain 7.59e-25
Family Tetramerization domain of potassium channels 0.00000744
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000016966   Gene: ENSSTOG00000019362   Transcript: ENSSTOT00000026391
Sequence length 511
Comment pep:known_by_projection scaffold:spetri2:JH393514.1:1933625:1935160:-1 gene:ENSSTOG00000019362 transcript:ENSSTOT00000026391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVCGWKEMEVALVNFDNSDEIQEEPGYATDFDPSNPKGRPGSSPFSNWKILISDSTNLE
TTFSKLPGDYADPPGPEPLVWNEGNQRVIINIAGLRFETQLRTLNQFPETLLGDREKRMQ
FFDSMRNEYFFDRNRPSFDGILYYYQSGGKIRRPANVPIDIFADEISFYELGSEAMDQFR
EDEGFIKDPETRLPTNEFHRQFWLLFEYPESSSAARGVAVVSVLVVVISITIFCLETLPE
FREDRELKVVRDPRLHANKTDLSQTMFSDPFFMVESTCIMWFTFELVLRFVVCPSKTDFF
RNLMNIIDIISIIPYFATLITELVQETEPSNQQNMSLAILRIIRLVRVFRVFKLSRHSKG
LQILGQTLKASMRELGLLIFFLFIGVILFSSAVYFAEVDEPESHFSSIPDGFWWAVVTMT
TVGYGDMCPTTPGGKIVGTLCAIAGVLTIALPVPVIVSNFNYFYHRETENEEKQNIPGEI
DKILNSVGSRTGSTDSLNKTNRGCASEKSRK
Download sequence
Identical sequences I3MXX1
XP_005338179.1.77405 ENSSTOP00000016966 ENSSTOP00000016966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]