SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000017132 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000017132
Domain Number 1 Region: 41-150
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-25
Family Spermadhesin, CUB domain 0.0009
Further Details:      
 
Domain Number 2 Region: 154-252
Classification Level Classification E-value
Superfamily LCCL domain 9.94e-25
Family LCCL domain 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000017132   Gene: ENSSTOG00000019521   Transcript: ENSSTOT00000024267
Sequence length 517
Comment pep:known_by_projection scaffold:spetri2:JH393468.1:547333:608374:1 gene:ENSSTOG00000019521 transcript:ENSSTOT00000024267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPRARGGGGALAAAPGPGLLALLLAVCAPLWLQAEELGDGCGHIVTYQDSGTMTSKNYP
GTYPNHTVCEKTITVPKGKRLILRLGDLDIESQTCASDYLLFTSSSDQYGPYCGRMTVPR
ELLLNTSEVTVRFESGSHISGRGFLLTYASSDHPDLITCLERGNHYLKTEYSKFCPAGCR
DIAGDISGNIIDGYRDTSLLCKAAIHAGIIADELGGRISVLLRKGISRYEGILANGVLSR
IGSLSEKRFLFTSTGINITTVAIPLVLLVALLLAGMGVFAALRKKKKKGNPYISAEAQKT
GCWKQIKYPFARHQSAEFTITYDNEKEITQKLDLITSDMADYQQPLMIGTGTVARKGSTF
RPIDTDADEAGTGAEASSHYDCPQRSAGRHEYALPLTHAEPEYATPIVERHLPRAHTFSA
QSGYHVPGPRPAHKHSLSSGSFSPEAGATKSGDYQLPQSPKPADRGYDKPKASSSFAAEN
RDFASQKPETNPGVNDGYSAPRDCLTPLNQTAVTALL
Download sequence
Identical sequences ENSSTOP00000017132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]