SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000017948 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000017948
Domain Number 1 Region: 316-373
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.54e-26
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 429-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.14e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 68-130
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.88e-22
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 4 Region: 372-429
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.35e-20
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 470-522
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-19
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 278-330
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.8e-19
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000017948
Domain Number - Region: 3-37
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.00426
Family SCAN domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000017948   Gene: ENSSTOG00000009229   Transcript: ENSSTOT00000025741
Sequence length 534
Comment pep:known_by_projection scaffold:spetri2:JH393284.1:22198418:22210030:1 gene:ENSSTOG00000009229 transcript:ENSSTOT00000025741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQQLLITLPTKASTWVKLHHPRKAKEGAPLWEDVTKIFEAEALPSQQVDESQGESCKDE
MTPGLLTAGSQELLTFKDVSVDFTQEEWGQLALDHQNLYREVMLENYGNLVSVGYQLCKP
VVISQLEKGEEPWLTEKKISGGSCSDLANKTETKESTLKNEISWEELHSGLIQERSTRRS
TLYSTLGRVSKCDKLESYLENQGRSPEGPIPSIHKKILTQEKSQESKQFDKKVNFSSKIT
PGLTGSSRTKDHKNDTPGKRNKCNLDLINHSRSYTKMKTFECNICEKNFKQLIHLTEHMR
IHTGEKPFRCKECGKAFSQSSSLIPHQRIHTGEKPYECKECGKTFRHPSSLTQHVRIHTG
EKPYECEICEKAFSQSIGLIQHLRTHVREKLFTCKDCGKAFFQIRHLRQHEIIHTGVKPY
ICNVCNKNFSHSTYLTQHQRTHTGERPYKCKECGKAFSQRIHLSIHQRVHTGVKPYECSH
CGKAFRHDSSFAKHQRIHTGEKPYDCNECGKAFSCSSSLIRHCKIHRNSFSNDT
Download sequence
Identical sequences ENSSTOP00000008274 ENSSTOP00000017948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]