SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000019171 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000019171
Domain Number 1 Region: 57-118
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.49e-26
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 2 Region: 466-523
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.19e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 522-579
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.41e-24
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 690-747
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.6e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 410-467
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-22
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 6 Region: 578-633
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-22
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 7 Region: 636-691
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 8 Region: 732-784
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.79e-17
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 9 Region: 372-424
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000946
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 10 Region: 299-356
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000132
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000019171   Gene: ENSSTOG00000025545   Transcript: ENSSTOT00000024811
Sequence length 794
Comment pep:known_by_projection scaffold:spetri2:JH393707.1:533355:553560:-1 gene:ENSSTOG00000025545 transcript:ENSSTOT00000024811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAINPWASWGALMDQSWGMAAVDPWASWALCPQDSAWHMDGSNEEGRRAAGHPAAQVQE
PVTFEDVAVDFTQEEWGQLDLVQRTLYRDVMLETYGHLLSVGNQIAKPEVISLLEQGEEP
WLVEQTCPESSCPEWMRDQESSALIPAQSSFNEEQSHGMKLKRYIWDDPWFSRLGVWGCK
DQLEMYHTNQSTAMRQMVFMQKQVLSQRGLNSEFCGLGAEYSQSVNFVPCQRVSQLEHFY
KPDVHAESWRCNSAIMYADKITCENSDCDKALYQSLHPVHPVKMQTGDDLFKCTDAVKSF
NHIIHFGDHKGMYTGEKLYEYKECHQIFNQSPSFNEHPRLHMGENQYDYKEYENIFYFSS
FMEHQKLGAVEKACKYNEWEKVFGYDSFLTQHTSSYNAEKPFEYSECGTSFIWSSYLIQH
KKSHAGEKPYECDKCGKAFRNRSALTKHERTHTGIKPYECNKCGKAFSWNSHLVVHKRIH
TGEKPYVCNECGKSFNWNSHLIGHQRTHTGEKPFECTECGKSFSWSSHLIAHMRMHTGEK
PFKCDECEKAFRDYSALSKHERTHSGAKPYKCTECGKSFSWSSHLIAHQRTHTGEKPYNC
QECGKAFRERSALTKHEIIHSGIKPYECNKCGKSCSQMAHLVRHQRTHTGEKPYECNKCG
KSFSQSCHLVAHRRIHTGEKPYKCNQCERSFNCSSHLIAHRRTHTGEKPYRCNECGKAFN
ESSSLIVHLRNHTGEKPYKCNHCEKAFCKNSSLIIHQRMHSGEKRFICSQCGRAFSGHSA
LLQHQRSHSEEKRP
Download sequence
Identical sequences ENSSTOP00000019171 ENSSTOP00000019171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]