SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000019490 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000019490
Domain Number 1 Region: 304-332,364-565
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.42e-59
Family Voltage-gated potassium channels 0.00058
Further Details:      
 
Domain Number 2 Region: 177-273
Classification Level Classification E-value
Superfamily POZ domain 1.23e-26
Family Tetramerization domain of potassium channels 0.00000466
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000019490   Gene: ENSSTOG00000020307   Transcript: ENSSTOT00000024069
Sequence length 654
Comment pep:known_by_projection scaffold:spetri2:JH393343.1:7593068:7595573:1 gene:ENSSTOG00000020307 transcript:ENSSTOT00000024069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVAMVSAESSGCNSHMPYGYAAQARARERERLAHSRAAAAAAVAAATAAVEGSGGSGGG
SHHHHQTRGACTSHDPQSSRGSRRRRRQRPEKKKVHHRQSSFPHCSDLMPSGSEEKILRE
LSEEEEEEEEEEEEEEEGRFYYSEDDYGEESSYTDLLPQDEGGGGGYSSVRYSDCCERVV
INVSGLRFETQMKTLAQFPETLLGDPEKRTQYFDPLRNEYFFDRNRPSFDAILYYYQSGG
RLKRPVNVPFDIFTEEVKFYQLGDEALLKFREDEGFVREEEDRALPENEFKKQIWLLFEY
PESSSPARGIAIVSVLVILISIVIFCLETLPEFRDDRDLVMALSAGGHSGLLNDTSAHHL
ENSGHTIFNDPFFIVETVCIVWFSFEFVVRCFACPSQALFFKNIMNIIDIVSILPYFITL
GTDLAQQQGGGNGQQQQAMSFAILRIIRLVRVFRIFKLSRHSKGLQILGHTLRASMRELG
LLIFFLFIGVILFSSAVYFAEADEPTTHFQSIPDAFWWAVVTMTTVGYGDMKPITVGGKI
VGSLCAIAGVLTIALPVPVIVSNFNYFYHRETENEEQTQLTQNAVSCPYLPSNLLKKFRS
STSSSLGDKSEYLEMEEGVKESLCAKEEKCQGKGDDSETDKNNCSNAKAVETDV
Download sequence
Identical sequences I3N544
ENSSTOP00000019490 XP_005327516.1.77405 XP_015333218.1.40921 ENSSTOP00000019490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]