SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000020641 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000020641
Domain Number 1 Region: 35-148
Classification Level Classification E-value
Superfamily PH domain-like 2.11e-37
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000572
Further Details:      
 
Domain Number 2 Region: 242-310,350-371
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 1.31e-27
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000135
Further Details:      
 
Domain Number 3 Region: 431-491
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000000115
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000020641   Gene: ENSSTOG00000028043   Transcript: ENSSTOT00000023392
Sequence length 503
Comment pep:known_by_projection scaffold:spetri2:JH393531.1:634706:641082:1 gene:ENSSTOG00000028043 transcript:ENSSTOT00000023392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGGPMGSRSGGRGGPTAQQNIPSTLLQDHENQRLFEMLGRKCWTLATAVVQLYLALPPG
AEHWTMEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYFTPTPFFHTFAGD
DCQVGLNFADEGEALAFRALVQEKIQKRSQRQSGDRRQLPPPPAPANEERRGGLPPLPPH
PGGDQGGPPAGPLSLGLVTVDIQNPDITNSRYRGLPAPGPGPADKKRSGKKKISKADIGA
PSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSKAGISEAQLTDAETSKLIYDFIEDQGGL
EAVRQEMRRQEPLLPPPPPCRGGNQPQRPPMVGGNKGRSGPLPPVPLGSAPPPPTPRGPL
PPGRGGPPPPPPPATGRSGPPPPPPPGIGGPPVPPPPPPPPPPPPSSGVGSVTPPTPSTL
VPGGGLSPGGGRGALLDQIRQGIQLNKTPGAIESSALQPPPQSSEGLVGALMHVMQKRSR
AIHSSDEGEDQAGDEFEDDEWDD
Download sequence
Identical sequences I3N8E5
ENSSTOP00000020641 ENSSTOP00000020641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]