SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000021200 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000021200
Domain Number 1 Region: 264-456
Classification Level Classification E-value
Superfamily Nudix 3.38e-45
Family NADH pyrophosphatase 0.001
Further Details:      
 
Domain Number 2 Region: 17-100
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.61e-18
Family Ankyrin repeat 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000021200   Gene: ENSSTOG00000025969   Transcript: ENSSTOT00000020442
Sequence length 462
Comment pep:known_by_projection scaffold:spetri2:JH393333.1:964883:981199:1 gene:ENSSTOG00000025969 transcript:ENSSTOT00000020442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSIKRSPKQEIISEFLSSAAEGDIAKLTGILSHSPSLLNETSENGWTALMYAARNGHPD
VVQFLLEKGCDRSTVNKSRQTALDIAIFWGYKHIANLLANAKGGKKPWFLTNEAEECENY
FSRTLLDRKSEKRNNSDWLLAKESHPATVYILFSDLSPLVTLGGNKESFQQPEVRLCQLN
HTDIKDYLTQPEKITLIFLGVELEMKKKLRNYDGEVPKEEEDGLIAWFALGIDPIAAEEF
KQRHENCYFLHPPMPALLQLKEKEAGVVAQARSVLAWHSRYKFCPTCGSATKIEEGGYKR
VCLKEDCPSLQGVHNTSYPRVDPVVIMQVIHPDGTKCLLGRQKRFPPGMFTCLAGFIEPG
ETIEDAVRREVEEESGVKVGHVQYVSCQPWPMPSSLMIGCLAVAVSTEIKVDKNEIEDAR
WFTREQVVDVLTKGKQQAFFVPPSRAIAHQLIKHWIGMNPNL
Download sequence
Identical sequences I3NA03
ENSSTOP00000021200 ENSSTOP00000021200 XP_005326177.1.77405 XP_013214458.1.77405 XP_013214459.1.77405 XP_015339612.1.40921 XP_015339619.1.40921 XP_015339627.1.40921 XP_015339634.1.40921 XP_015339642.1.40921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]