SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000022045 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000022045
Domain Number 1 Region: 755-982
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.01e-60
Family DBL homology domain (DH-domain) 0.00000000124
Further Details:      
 
Domain Number 2 Region: 360-537
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.09e-52
Family Regulator of G-protein signaling, RGS 0.000000034
Further Details:      
 
Domain Number 3 Region: 986-1120
Classification Level Classification E-value
Superfamily PH domain-like 2.11e-43
Family Pleckstrin-homology domain (PH domain) 0.000000282
Further Details:      
 
Domain Number 4 Region: 39-133
Classification Level Classification E-value
Superfamily PDZ domain-like 5.52e-21
Family PDZ domain 0.026
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000022045
Domain Number - Region: 160-170
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00915
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000022045   Gene: ENSSTOG00000010592   Transcript: ENSSTOT00000020703
Sequence length 1361
Comment pep:known_by_projection scaffold:spetri2:JH393390.1:6065948:6177664:-1 gene:ENSSTOG00000010592 transcript:ENSSTOT00000020703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVRLPQSIDRSASKKQSHLSRLSSLSALGDSAPEHKSPSHHRQPSDTSETTGLVQRCVI
IQKDQHGFGFTVSGDRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTMVTNSSHLEVVKLI
KSGAYVALTLLGSSPSSVSVSGLQQEPFLTGAPRVVPVIPPPPPPPLPPPQRITGPKPLQ
DPEVQKHATQILRNMLRQEEKELQRICEVYSRNPASLLEEQIEGARRRVSQLQLKIQQET
GGLVDILPPCGDTSQRPSEGRLSLDSQEADSGLDSGTERFPSLSESLMNRNSVPSDPGLD
SPRTSPVIMARVAHHHRRQGSDVPIPSSSDQGIDQSPKPLIIGPEEDYDPGYFNNESDIV
FQDLEKLRSRPAHLAVFLRYIFSQADPSPLLFYLCAEVYQQTNPKDSRSLGKDIWNIFLE
KNAPLRVKIPDMLQAEIDLRLRNGEDVRGILCEAQEAAMPEIQEQIHDYRTKRTLGLGSL
YGENDLLDLDGDPLRERQIAEKQLAALGDILAAAVRGVAGAPMDFALNTYMSHAGIRLRE
ARPSNTIEKAQSAPDKDKWLPFFPKTKKSSNSKKEKDALEDKKRNPILKYIGKPKSSSQS
IKPGNVRNIIQHFENSQQYDAPEPGTQRLSTGSFPEDLLESDSSRSEIRLGRSESLKGRE
EMKRSRKAENVPRSRSDVDMDAAAEATRLHQSASSSASSLSTRSLENPTPPFTPKMGRRS
IESPSLGFCTDALLPHLLEDDLGQLSDLEPEPDAQNWQHTVGKDVVAGLTQREIDRQEVI
NELFVTEASHLRTLRVLDLIFYQRMKKENLMPREELARLFPNLPELIEIHNSLCEAMKKL
RDEGPIIKEISDLMLARFDGPAQEELQQVAAQFCSYQSIALELIKTKQRKESRFQLFMQE
AESHPQCRRLQLRDLIISEMQRLTKYPLLLENIIKHTEVGTPEYEKLCRARDHCREILKF
VNEAVKQTENRHRLEGYQKRLDATALERASNPLAAEFKSLDLTTRKMIHEGPLTWRISKD
KTLDLHVLLLEDLLVLLQRQDERLLLKCHSKTAVGSSDSKQTFSPVLKLNAVLIRSVATD
KRAFFIICTSELGPPQIYELVALTSSDKNTWMELLEEAVRNATRHPGAAPTPTHPPPRGP
QEPPAPCRETSPSILDDSEVFHSEPESEELPGGTESQQRVQGKQPRPPEDPEQESSTEEE
EPGAMPHLPASLDGRKRDPIELSLPGPLFIEGLADSALEDVENLRRLILWSLLPGHTVDT
PAVGEPEDDLTPTPSVISITSHPWDPGSPGQAPAGDDGDNTQLPGPEGAQAEQKDTALCS
LAHLPPRTRNSGIWESPELDRSPPEEAPGTEAAGSYKVVRK
Download sequence
Identical sequences ENSSTOP00000022045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]