SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000023550 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000023550
Domain Number 1 Region: 36-126
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.61e-36
Family SCAN domain 0.0000647
Further Details:      
 
Domain Number 2 Region: 407-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.47e-25
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 3 Region: 742-799
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 799-855
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.4e-23
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 5 Region: 518-575
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.4e-22
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 6 Region: 911-967
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.55e-22
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 7 Region: 630-687
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-21
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 8 Region: 855-911
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.86e-21
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 9 Region: 463-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 10 Region: 211-268
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.32e-20
Family KRAB domain (Kruppel-associated box) 0.0022
Further Details:      
 
Domain Number 11 Region: 574-631
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.03e-20
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 12 Region: 687-743
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.92e-19
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 13 Region: 368-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000492
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 14 Region: 952-1002
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000111
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000023550   Gene: ENSSTOG00000022902   Transcript: ENSSTOT00000019634
Sequence length 1029
Comment pep:known_by_projection scaffold:spetri2:JH393505.1:985590:999288:-1 gene:ENSSTOG00000022902 transcript:ENSSTOT00000019634 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRENWAHNALRQEGLVKGKDDTWKWGTSFQGSSSSVWETSHMHFRQLRYHETSGPQEAL
SRLRELCRRWLRPEARTKAQILELLVLEQFLSILPGEIRTWVQLHRPGSGEEAVALVEEL
QKDLDGPALKGPFLVQDQDILQEGLSAPGTAFVPASPSSHLSAEIHLNPLSDTVVFNLQD
PPHDSPAPEASALSQEENPRNQLMALMLLTAQPQELVMFEEVSVCFTSEEWACLGPIQRA
LYWDVMLENYGNVTSLEWETMTDNEEVTSKPSISQRADAQKGISKRLQGSVSQVPGFEEE
CEWQVLENQWGNETGERVDAMKKGSLCEQDKKKRTLPEKRGQKWKEFGESLTLGSAVSES
LIGTEGKKYYKCDICCKHLNKISHLINHRRIHTGEKPHKCKECGKGFIQRSSLLMHLRNH
SGEKPYKCNECGKAFSQSAYLLNHQRIHTGEKPYKCKECGKGFYRHSGLIIHLRRHSGER
PYKCNECGKVFSQNAYLIDHQRLHKGEEPYKCNKCQKAFILKKSLILHQRIHSGEKPYKC
DECGKTFAQTTYLVDHQRLHSAENPYKCKECGKVFIRSKSLLLHQRVHTEKKTFGCKKCG
KIFSSKSNLIDHKRMHSREKPYKCTECGKAFTQSAYLFDHQRLHNGEKPYECNECGKVFI
LKKSLILHQRFHTGENLYECKDCGKVFGSNRNLIDHERLHNGEKPYECRECGKTFIMSKS
FMVHQKLHTQEKAYKCEDCGKAFSYNSSLLVHRRIHTGEKPFECSECGRAFSSNRNLIEH
KRIHSGEKPYECNECGKCFILKKSLIGHQRIHTREKSYKCNDCGKVFSYRSNLIAHQRIH
TGEKPYACNECGKGFTYNRNLIEHQRIHSGEKTYECHICRKVLTSSRNLMVHQRIHTGEK
PYKCNECGKDFSQNKNLVVHQRMHTGEKPYECEKCRKSFTSKRNLVGHQRIHTGEKPYGC
NDCSKVFRQRKNLTVHQKVHTEEKPCECGEAEKEFSQTSKLHFQQKVHTVEEFSWLKNAS
EAKIEIQKI
Download sequence
Identical sequences ENSSTOP00000023550 ENSSTOP00000023550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]