SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000023749 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000023749
Domain Number 1 Region: 205-434
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.84e-55
Family Voltage-gated potassium channels 0.00079
Further Details:      
 
Domain Number 2 Region: 42-160
Classification Level Classification E-value
Superfamily POZ domain 2.41e-28
Family Tetramerization domain of potassium channels 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000023749   Gene: ENSSTOG00000020827   Transcript: ENSSTOT00000025220
Sequence length 502
Comment pep:known_by_projection scaffold:spetri2:JH393280.1:35114111:35119831:1 gene:ENSSTOG00000020827 transcript:ENSSTOT00000025220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELPHSGRTPLGSPLDSCSLASLDSSVFCSEGEGEPLALGDCFTVNVGGSRFVLSQQALS
CFPHTRLGKLAVVVASYRRLGALAAAPSPLELCDDANPVDNEYFFDRSSQAFRYVLHYYR
TGRLHVMEQLCALSFLQEIQYWGIDELSIDSCCRDRYFRRKELSETLDFKKDTDDQESQH
ESEQDFSQGPCPTVRQKLWNILEKPGSSTAARIFGVISIIFVAVSIVNMALMSAELSWLN
LQLLEILEYVCISWFTGEFVLRFLCVRDRCRFLRKVPNIIDLLAILPFYITLLVESLSGS
QTTQELENVGRIVQVLRLLRALRMLKLGRHSTGLRSLGMTITQCYEEVGLLLLFLSVGIS
IFSTIEYFAEQSIPDTTFTSVPCAWWWATTSMTTVGYGDIRPDTTTGKIVAFMCILSGIL
VLALPIAIINDRFSACYFTLKLKEAAVRQREALKKLTKNIATDSYISVNLRDVYARSIME
MLRLKGRERASTRSSGGDDFWF
Download sequence
Identical sequences I3NHA2
ENSSTOP00000023749 ENSSTOP00000023749 XP_005316282.1.77405 XP_015341996.1.40921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]