SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000030 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000030
Domain Number 1 Region: 526-751
Classification Level Classification E-value
Superfamily vWA-like 8.74e-60
Family Integrin A (or I) domain 0.00012
Further Details:      
 
Domain Number 2 Region: 28-216
Classification Level Classification E-value
Superfamily vWA-like 9.56e-55
Family Integrin A (or I) domain 0.00032
Further Details:      
 
Domain Number 3 Region: 214-333
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000706
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 4 Region: 761-804
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.000000000405
Family Chicken cartilage matrix protein 0.0027
Further Details:      
 
Domain Number 5 Region: 406-445,475-565
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000691
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000030   Gene: ENSGACG00000000022   Transcript: ENSGACT00000000030
Sequence length 805
Comment pep:known_by_projection scaffold:BROADS1:scaffold_89:230109:238032:-1 gene:ENSGACG00000000022 transcript:ENSGACT00000000030 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALCGFVLTTLLVLASARPKAGPEQKCKSGPVDLVFLIDSSRSVRPHEFETMRKFMIDI
LSTLDIGLNATRVGVVQYSSQVRSEFSLKTHPGLDAMVKGINEIIPLAQGTMTGLAIKYV
MNSAFIDEEGDRPKVPNVAVIVTDGRPQDRVAEVAAEARGKGIEIYAVGVARADMASLRA
MASPPFEDHVFLVESFDLIHQFGLQFQDKLCGVDLCLESEHSCEHICESSPGSFHCLCLP
GYTLREDGKTCAAIDLCAEERHDCEQICVTSPGSFTCDCNKGFKLDEDKKSCTMIDYCSF
GNHSCDHECEGVLNGYFCRCHQGYRLLDAKRCEGESTTMAHRHTTHTPQCMVTAGLHINV
RIISNLCIYIRIIFIHRIDETVSMIYFVVKSTHTHFILMCVCPPAIDLCAEEKHNCEQIC
FSAPGVFTCDCNEGFKLNEDKKTCTRLEYKIVLHLCSLKTSLRRSAAVHCVTIDLCAEGK
DDCEQICVSARGVFTCDCNEGFKLNEDRKTCTTLLSPCVSADMDLCSSVQHGCEHQCVST
PGSFYCVCPEGQLLQEDGQSCGSCKSANIDLVLLIDGSKSVRPQNFELVKKFVNQVVDSL
DVSAQGTRVGLVQYSSRVRTEFPLNRHHTADEIKAAVMKVDYMEKGTMTGLALKHMLETS
FSEAEGARPADRNIPRVGLVFTDGRSQDDITEFAKKAKEAAGITMYAVGVGKAVEDELRE
IASEPLEKHFYYTTDFSAISTIAENLKLNVCPAESQGKIEVKDPCACESLVEFQQATMSS
LEQLTTMHLLSAMTARLEQLENQLL
Download sequence
Identical sequences G3N413
ENSGACP00000000030 ENSGACP00000000030 69293.ENSGACP00000000030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]