SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000031 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000031
Domain Number 1 Region: 17-205
Classification Level Classification E-value
Superfamily vWA-like 2.62e-55
Family Integrin A (or I) domain 0.00032
Further Details:      
 
Domain Number 2 Region: 327-428
Classification Level Classification E-value
Superfamily vWA-like 7.63e-26
Family Integrin A (or I) domain 0.0027
Further Details:      
 
Domain Number 3 Region: 205-249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000753
Family EGF-type module 0.025
Further Details:      
 
Domain Number 4 Region: 239-287
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000367
Family EGF-type module 0.01
Further Details:      
 
Domain Number 5 Region: 287-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000495
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000031   Gene: ENSGACG00000000022   Transcript: ENSGACT00000000031
Sequence length 428
Comment pep:known_by_projection scaffold:BROADS1:scaffold_89:231476:237999:-1 gene:ENSGACG00000000022 transcript:ENSGACT00000000031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLVLASARPKAGPEQKCKSGPVDLVFLIDSSRSVRPHEFETMRKFMIDILSTLDIGLNAT
RVGVVQYSSQVRSEFSLKTHPGLDAMVKGINEIIPLAQGTMTGLAIKYVMNSAFIDEEGD
RPKVPNVAVIVTDGRPQDRVAEVAAEARGKGIEIYAVGVARADMASLRAMASPPFEDHVF
LVESFDLIHQFGLQFQDKLCGVDLCLESEHSCEHICESSPGSFHCLCLPGYTLREDGKTC
AAIDLCAEERHDCEQICVTSPGSFTCDCNKGFKLDEDKKSCTMIDYCSFGNHSCDHECEG
VLNGYFCRCHQGYRLLDAKRCEDMDLCSSVQHGCEHQCVSTPGSFYCVCPEGQLLQEDGQ
SCGSCKSANIDLVLLIDGSKSVRPQNFELVKKFVNQVVDSLDVSAQGTRVGLVQYSSRVR
TEFPLNRH
Download sequence
Identical sequences G3N414
ENSGACP00000000031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]