SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000099 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGACP00000000099
Domain Number - Region: 41-92
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000287
Family Complement control module/SCR domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000099   Gene: ENSGACG00000000081   Transcript: ENSGACT00000000099
Sequence length 181
Comment pep:known_by_projection scaffold:BROADS1:scaffold_99:284369:287918:1 gene:ENSGACG00000000081 transcript:ENSGACT00000000099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAATASIADVPRTDSTAGEDNRDRRSKSGRTQAQCTLRPLPALGTQRIIQGNGTTVGTV
ISLQCPAKHKLVGKDMKCVMDTNSTHWVGNTYCKPVSPFEDYGFRVAVLASIVSLAVIFF
MSVAFITCCLLDCIKEDKRNKHERDSEMWQWEEQAQHGGDGRPRCRQEGWNNNNNNTTQE
K
Download sequence
Identical sequences G3N479
ENSGACP00000000099 69293.ENSGACP00000000099 ENSGACP00000000099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]