SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000128 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000128
Domain Number 1 Region: 611-889
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.69e-83
Family Protein kinases, catalytic subunit 0.000000000577
Further Details:      
 
Domain Number 2 Region: 2-173
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.8e-74
Family Ephrin receptor ligand binding domain 0.00000107
Further Details:      
 
Domain Number 3 Region: 298-502
Classification Level Classification E-value
Superfamily Fibronectin type III 3.4e-40
Family Fibronectin type III 0.00024
Further Details:      
 
Domain Number 4 Region: 912-980
Classification Level Classification E-value
Superfamily SAM/Pointed domain 6.7e-18
Family SAM (sterile alpha motif) domain 0.00022
Further Details:      
 
Domain Number 5 Region: 229-298,336-356
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000942
Family Growth factor receptor domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000128   Gene: ENSGACG00000000101   Transcript: ENSGACT00000000128
Sequence length 986
Comment pep:known_by_projection scaffold:BROADS1:scaffold_165:50091:87994:1 gene:ENSGACG00000000101 transcript:ENSGACT00000000128 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTLLDSRSVQGELGWVANPTEGGWEEVSIMDEKNIPIRTYQVCNVMEPNQNNWLRTDWIP
RGGAQRVYIEIKFTLRDCNSLPGVMGTCKETFNLYYYESNNDKERYIRENQFGKIDTIAA
DESFTQVDIGDRIMKLNTEVRDVGALSRKGFYLAFQDVGACIALVSVRVFYKKCPLAVRN
LAQFPDTITGADTSSLVEVRGSCVDNSEEKEVPKMYCGADGEWLVPIGNCLCNPGYDERN
AECQACKIGYFRALATDGSCAKCPLHSYSVREGSTSCVCDKGYFRSETDPASMPCTRPPS
APAHLISNVNETSVNLEWSPPLASGGRLDLTYNVVCKRCGPDGRRCQACGNGVHFSPQQL
SLKGTKVSINELQAHTNYTFEVWAVNGVSPQSPGPEQAVSVTVTTNQAAPSPVTSIQAKD
ITRHTISLAWHPPDRANGVILEYEVKYYEKDQNERSYRIIKTSLRNTDIKSLTPLTSYVF
HVRARTAAGYGEFSGPFEFMTNSVPAPIIGDGANSTVLLVSVVGSVVLLIILISAFVISR
RCECASSYGRLSAICMCALVLRMMRRSKYSKAKQDSDEEKHLHQERLSPGVRIYVDPFTY
EDPNQAVREFAKEIDASCIKIEKVIGIGEFGEVCSGRLKMPGKREICVAIKTLKAGYTDK
QRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTVIQ
LVGILRGIASGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLEDDPEAAYTTQ
GGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIDEGYR
LPPPMDCPVALHQLMLDCWQRERADRPKFGQIVNMLDKLIRNPNTLKRTGGDATVRPNTT
LLEPGSPEAASAVGTVEDWLQAIGMERYSDNFTGAGYTTPEAVVHMTQEDMARIGITMAA
HQNKILTGVQGMLSQMQQIQGRMVPV
Download sequence
Identical sequences G3N4A8
ENSGACP00000000128 ENSGACP00000000128 69293.ENSGACP00000000128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]